KEGG   Opitutus terrae: Oter_0972Help
Entry
Oter_0972         CDS       T00689                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
ote  Opitutus terrae
Pathway
ote00020  Citrate cycle (TCA cycle)
ote00620  Pyruvate metabolism
ote01100  Metabolic pathways
ote01120  Microbial metabolism in diverse environments
ote01200  Carbon metabolism
ote01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ote00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Oter_0972
   00620 Pyruvate metabolism
    Oter_0972
Enzymes [BR:ote01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Oter_0972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N HMGL-like Biotin_carb_C Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_D23 HlyD_3 GCV_H LAL_C2 ATG16
Motif
Other DBs
NCBI-ProteinID: ACB74260
UniProt: B1ZXN8
Position
1190964..1194461
Genome map
AA seq 1165 aa AA seqDB search
MAANRSEIAVRIFRAGTELGLRTVAVFAQEDRFCIHRYKADEAYQIGDGKGPVAAYLDIE
SIIDVAKRRGVDAIHPGYGFLSENAELARACERAGLIFVGPRPELLDMMGDKTAARALAQ
RIGVPVLPGTEEPLTDRDEALRVAKSIGFPLIIKAAFGGGGRGMRIVHKPADMAGLLDEA
QAEAGRAFGNPAVFLEKYIPRAKHIEVQVLGDRHGNVIHLHERDCSVQRRHQKVVEVAPS
YGLPETIVAELCEAAAKLARSIRYDNAGTIEFLYDLDRHEWFFIEMNPRIQVEHTITEVI
TGLDLVRAQILIAQGHALHSREVGMPPQSAVPRLGYAIQSRITTEDPANKFIPDYGRIMV
YRSPGGFGVRLDGGMGFAGAVITPFYDSLLVKCITSGDTYESAIHRARRALAEFRIRGVK
TNIPFIENVIAHPLFQSGQATTMLIDTSPELLSFRPRRDRATKLLNFLGNVIVNGNPHAK
GYKPGKSLLPAVPPAGGRGEPPRGTRQLLLELGPKKFAEWTLKQKRLLITDTTLRDAHQS
LMATRVRTYDMRAVADALAHHAPGLFSLEMWGGATFDTAMRFLYEDPWDRLRQLRAAVPN
ICFQMLLRGANAVGYTNYPDHVVAGFVRHAASAGMDIFRIFDSLNYLPNLRVAMEAVQDT
HAVCEAAICYTGDILDGKRDKFSLQYYVKLARELERMGAHFLAIKDMAGLCRPYAAYKLV
KALREEIGLPIHFHTHDTSGIAATSVLRASDAGVDVVDLAIASMSGSTSQPNLNSIVAAL
QHTPRDPQLDLERLNAVSDYWEHVREFYRPFDTAPKTGSAEVYLHEMPGGQYTNLKEQAA
SMGVSHRWPEIARTYAEVNQLFGDIVKVTPSSKVVGDLALFLFSRGIRPADVVNLPPGTT
PYPESVIDMLMGGLGWPEGGWPEAVWRAILGEARFKEAKAKYTAATRATKSRAKSPESRA
GHKLSAPDSQLSALRDELAEKLRHQPSDDELFSHLMYPQVFADFAKHEREFGDVSVLPTP
AFFYGLQPAEEISVEIEEGKVLIIRLVSVGAPDKDGRRTIAYELNGISREALIVDRSVAP
KAKPRLKADLANPLQVAAPIPGLVVVLNVSVGTKVTKGDKLFMMEAMKMQTTVYAQADGV
VAELHAAVGDTVEAKDLVVTLRDGE
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgaaccgcagcgagattgccgtgcgcatcttccgcgccggcaccgaactcggg
ctccgcacggtcgcggtctttgcccaggaggatcggttctgcatccatcgctacaaggcc
gacgaggcgtatcagatcggtgacggcaagggtccggttgcggcgtatctggacatcgag
agcatcatcgacgtcgcgaagcgccgcggcgtggacgccattcacccgggttacggcttc
ctctcggagaacgccgagctcgcccgcgcgtgcgagcgggcgggcctgatcttcgtcgga
ccgcggcccgaactgctcgacatgatgggcgacaagaccgcggctcgcgcgctcgcccag
cggatcggcgtgccggtgctgccgggcacggaggagccgctgaccgatcgcgacgaggcg
ttgcgcgtcgcgaaatcgatcggattcccgttgatcatcaaggcggccttcggcggcggc
ggtcgcggcatgcggatcgtgcacaagccggccgacatggccgggctgctcgacgaagcg
caggcggaggccggccgcgcgttcggcaatccggcggtttttctggagaaatacatcccg
cgcgcgaagcacatcgaggtgcaggtactcggcgaccggcacggcaacgtgatccatctc
cacgagcgcgattgctccgtgcagcgccggcaccagaaggtcgtcgaagtggcgccgagc
tacgggctgccggagacgatcgtcgccgagctctgcgaagcggcggccaagctcgcgcgt
tccattcgctacgacaacgcgggcacgatcgaatttctctacgatctcgaccggcacgag
tggttcttcatcgagatgaacccgcgcatccaggtcgagcataccatcaccgaggtgatc
actggccttgatctggtgcgcgcgcagatcctgatcgcgcagggccacgccttgcactcg
cgcgaggtgggcatgccaccgcaatccgccgtgccgcggctgggctatgcgatccagagc
cggatcaccaccgaggatccggcgaacaagttcattcccgactacgggcgaatcatggtg
taccgctcgcccggaggcttcggcgtgcggctcgacggcggcatgggcttcgccggcgcg
gtgatcacgccgttctacgactcgctgctcgtgaagtgcatcaccagcggcgacacctac
gagagcgcgatccatcgcgcacgtcgcgcgttggcggagttccggatccgcggcgtcaaa
accaacattccttttatcgaaaacgtcatcgcgcacccgctgttccagagcggccaggcg
acgacgatgctgatcgacacctcgcccgaattgctgtccttccggccgcgccgcgaccgc
gcgaccaagctgctgaattttctgggcaacgtcatcgtcaacggcaatccacacgcgaag
ggctacaagcccggaaagtcactcctgccggccgtgccgcccgcgggcggtcgcggcgaa
ccgccgcgcggcacgcgccagctgctgcttgagctcggcccgaaaaaatttgcggagtgg
acgctcaagcagaagcggctgctgatcaccgacaccacgctgcgcgacgcgcatcaatcg
ttgatggccacgcgcgtgcgcacctacgacatgcgcgcggtggccgacgccctggcgcat
cacgcaccggggctgttctcgctggagatgtggggcggcgcgaccttcgacaccgcgatg
cgcttcctctacgaggacccgtgggaccggctgcggcagctgcgcgcggcggtgcctaac
atctgtttccagatgctgctacgcggcgcgaacgcggtgggctatacgaactatccagac
cacgtggtcgccgggttcgtccgtcacgccgcgtcggcgggcatggatattttccgaatc
ttcgactcgctgaactatctgccgaacctgcgcgtcgccatggaggcggtgcaggatacg
cacgcggtctgcgaggcggcgatctgctacaccggcgacatcctcgacgggaaacgcgat
aagttcagcctgcagtattacgtgaaacttgcccgtgagctggagcggatgggcgcgcat
ttcctcgcgatcaaggacatggccggactctgccgaccctacgctgcctacaagctggtg
aaggcgctgcgggaggagatcgggctgccgatccatttccatacgcacgacaccagcggg
atcgccgcgacatcggtgctgcgggcgagcgacgcgggcgttgacgtggtcgacctcgcg
atcgcctcgatgagcggcagcacgtcgcagccgaacctgaactcgatcgtcgccgcactg
cagcatacgccgcgcgatccacagctcgatctggaacggttgaatgcggtctccgattac
tgggaacacgtgcgtgagttctaccggccgttcgacaccgcgcccaagaccggctcggcg
gaggtttacctgcacgagatgccgggcgggcagtatacgaacctcaaggagcaagctgcg
tcgatgggggtgtcgcaccgctggcccgaaatcgcgcgcacctacgcggaggtgaaccag
ctgtttggcgacatcgtgaaggtcacgccttcctcgaaagtcgtgggcgatctcgcgctg
ttcctcttttcgcgcggcatccgaccggcggatgtcgtcaacctgccgcccggtaccacg
ccttatccggagagcgtgatcgacatgctgatgggcggactcggttggccggagggcggc
tggcccgaagccgtatggcgtgcgatcctcggcgaggcgcgcttcaaggaggcgaaggca
aaatacacggccgcgacccgcgcgactaagtccagagccaagagtccagagtccagagcg
ggccacaagctctcagctccagactctcagctctcagctttgcgcgacgaactcgccgag
aaacttcggcaccagccgagcgacgacgagttgttctcacacctgatgtatccgcaggtg
tttgccgatttcgccaaacacgagcgcgagttcggcgacgtgagcgtgctgccgacgccc
gcgttcttctacgggttgcagcccgcggaggaaatctcggtcgagatcgaggaaggcaag
gtgctgatcatccggctcgtatcggtcggcgcgccggacaaggacggtcgccgcaccatt
gcttacgagctcaacggcatctcgcgcgaagcgctgatcgtcgaccgcagcgtcgcgccg
aaggcgaagccgcggctcaaggccgacctcgcgaatccgctgcaggtcgccgcgccgatt
cccggactcgtcgtggtgctgaacgtgtcggtcggcacaaaagtcacgaagggcgacaag
ctcttcatgatggaagcgatgaaaatgcagaccacggtgtacgcgcaggcggatggcgtc
gtggccgagttgcacgccgccgtcggcgacaccgtcgaagcgaaggacctcgtcgttacc
ctgcgcgacggcgaatag

DBGET integrated database retrieval system