KEGG   Opitutus terrae: Oter_1287Help
Entry
Oter_1287         CDS       T00689                                 

Definition
(GenBank) Glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
ote  Opitutus terrae
Pathway
ote00511  Other glycan degradation
ote00600  Sphingolipid metabolism
ote01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Oter_1287
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Oter_1287
Enzymes [BR:ote01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Oter_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: ACB74572
UniProt: B1ZR85
Position
1598424..1599854
Genome map
AA seq 476 aa AA seqDB search
MYSHFRSLTLLASFGGASFAFAAGVPSAQVYLTQKDAPHRLAATGALRFAPLPQPMEKQQ
CVFVDPTHEFETLLGIGGAITDAAAETFDKLPETKRAELLRAYYDPRAGIGYSLARTHIN
SCDFSSGSYTYVAEGDRELKSFDIAPDLRHRIPLLRAALKTAGPGLTVYASPWSPPAWMK
DSGDMLHGGKLRPDMRAAWANYFVKFIHAYEQAGVPLWGVTVQNEPMAVQIWESCIFTAE
EERDFVRDHLGPTLKASGLGGKKIVGWDHNRTQLYQRATTLLSDPAAAQYLWGLGFHWYV
NDTFENVRRVRDAFPQAQLMMTEGCNGPFDFAKMNDWDLAENYGRSMIHDFNNGAVGWTD
WNILLDETGGPNHVGNFCFAPVHGDTRTGELHFTPAFYYIGHFSKFIRPGARRIIASPTV
DRLIATAFKNTDGSIAVVVMNQSAEDQPFHVWMNGQAASTRCPARSIMTVVIGVEQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtattcacacttccgctcactcacgttgctggcatcgtttggcggcgcgtcgttcgcg
tttgccgccggcgtgccctccgcgcaggtttacctgacgcaaaaagacgcgccgcaccgg
ctcgcggcgaccggagccttgcgcttcgcaccgttgccccagcccatggagaagcagcag
tgcgtgtttgtggatccgacgcacgagttcgaaacactgctcggcattggcggcgcgatc
accgacgcggcggcggagacattcgacaagctgccggagacgaaacgcgcggagctgcta
cgcgcctactacgatccacgagccgggatcggttactcgctcgcgcggacccacatcaac
agctgcgatttttcctccggcagctacacctacgtggcggagggtgaccgcgagctgaag
agcttcgatatcgcgccggacctgcgacaccggatcccgctgctgcgggcggcgctgaag
accgccggaccggggttgacggtttacgccagcccgtggagcccaccggcgtggatgaag
gacagcggcgacatgctgcatggcggcaagctgcggccggacatgcgcgcggcgtgggcg
aactatttcgtaaagttcatccacgcctatgaacaagcgggcgtgccgctctggggcgtg
acggtgcagaacgagccgatggcggtgcagatctgggagtcgtgcatcttcacggcggag
gaggagcgcgacttcgtgcgcgatcacctcggcccgacactgaaggcgagcgggctgggc
gggaagaagatcgtcggctgggaccacaaccgcacgcaactctaccagcgcgcgacgacg
ttgctcagcgatcctgccgccgcgcagtatctgtggggcctcgggtttcactggtatgtg
aacgacacgttcgaaaacgtccgccgcgtgcgcgatgccttcccgcaagcgcagttgatg
atgaccgaggggtgcaacggaccattcgatttcgccaagatgaacgactgggatctggcc
gaaaactacggccgctcgatgatccacgatttcaacaacggtgcggtcggttggaccgac
tggaacatcctgctcgacgagacgggcgggccgaaccacgtggggaacttctgctttgcg
ccggtgcatggcgacacgcggacgggcgagctgcatttcacgccggcgttctactacatc
ggccatttttcgaagttcatccgacccggcgcgcggcggatcatcgcctcgccgacggtg
gaccggttgatcgcgacggcgttcaaaaacaccgacggcagcatcgctgtcgtggtgatg
aatcagtcggccgaagatcagccgttccacgtctggatgaacggccaggcagcgtctacg
cgctgtccggcgcggtcgatcatgacggtggtgatcggggtggagcagtga

DBGET integrated database retrieval system