KEGG   Opitutus terrae: Oter_1401Help
Entry
Oter_1401         CDS       T00689                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ote  Opitutus terrae
Pathway
ote00010  Glycolysis / Gluconeogenesis
ote00030  Pentose phosphate pathway
ote00051  Fructose and mannose metabolism
ote00052  Galactose metabolism
ote00680  Methane metabolism
ote01100  Metabolic pathways
ote01110  Biosynthesis of secondary metabolites
ote01120  Microbial metabolism in diverse environments
ote01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oter_1401
   00030 Pentose phosphate pathway
    Oter_1401
   00051 Fructose and mannose metabolism
    Oter_1401
   00052 Galactose metabolism
    Oter_1401
  Energy metabolism
   00680 Methane metabolism
    Oter_1401
Enzymes [BR:ote01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Oter_1401
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Oter_1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACB74686
UniProt: B1ZS10
Position
complement(1761384..1762640)
Genome map
AA seq 418 aa AA seqDB search
MAELVGNVLVGQSGGPTAVINASVAGIVAEALNHECIEEIYGALNGVLGILQEDLIDLAA
ESQQQIRALRHTPGAALGTCRYKLKKQSDYERVLEVFKAHNIRYFFYIGGNDSQDTADKI
SKLAQQQGYELRVIGVPKTIDNDLPITDHTPGYGSVVKYTATTIRELACDHEAMGQGDLV
SIVEVMGRSAGWIAAGAALAKRRDHPHDPPHLIYLPEIPFDQAKCLEDVRRVLKREKFCM
VVVGEGLIDADGNYVAADAATDSFGHAQLGGAGDFLKELVETNIPGVKARLAKPGIIQRA
AAHAGSKTDADEAFLAGQAAVQAAIKGETDKMVTLVRGDTDHYTCETGLAPLAEIANGVK
KLPREWINEDGTSMNFQFLRYAQPLIQGEVAVPFESGVPVFARLDKVRVDKTLPAFVA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactcgtaggaaatgtcttggtgggccagtcgggtggccctaccgccgtcatc
aacgcgagcgttgccggaattgtggccgaagcgctcaaccacgagtgcattgaagagatc
tatggcgcgttgaacggcgtcctcgggatccttcaggaagatctgatcgacctcgccgct
gagtcccagcagcagatccgcgcgctccggcacactccgggtgcggcgctcggcacctgc
cgctacaagctgaagaagcagtccgactacgagcgcgtgctcgaggtcttcaaggcgcac
aacatccgctactttttctacatcggcggcaatgactcgcaggacaccgccgacaagatc
tccaagctcgcgcagcagcagggctacgaactgcgcgtcatcggcgtgccgaagacgatc
gacaacgatctcccgatcaccgaccacacgccgggctacggcagcgtggtgaaatacacc
gccacgacgatccgcgagctcgcctgtgatcacgaagccatgggccagggcgatctcgtc
tcgatcgtggaagtcatgggccgcagcgcgggctggattgccgccggcgccgcgctggcg
aagcgccgcgatcacccccacgatccgccgcacctgatttacctcccggaaatcccgttc
gaccaggccaagtgcctcgaggacgtccgccgcgtgctcaagcgcgagaaattctgcatg
gtcgtcgtcggcgagggcctgatcgacgccgatggcaactacgtcgccgccgatgcggcg
accgattcgttcggtcacgcgcagctcggcggcgcgggcgattttctgaaggagctggtc
gagacgaatattccaggcgtgaaagcccgcctcgcgaagccgggcatcatccagcgcgcc
gccgcccatgccggctcgaagaccgacgccgacgaggcgttcctcgccggccaggccgcc
gtgcaggccgcgatcaagggcgaaaccgacaagatggtcacgctcgtccgcggtgacacg
gaccactacacctgtgagaccgggctggcgccgctcgccgagatcgccaacggcgtgaag
aagctgccgcgcgagtggatcaacgaggacggcacgagcatgaacttccagttcctgcgc
tatgcccagccgctgattcagggcgaggtcgccgtgccgttcgagagcggcgtgccggtg
ttcgcgcggctcgacaaggtgcgcgtcgacaagacgctgccggcgttcgtcgcctga

DBGET integrated database retrieval system