KEGG   Opitutus terrae: Oter_2301Help
Entry
Oter_2301         CDS       T00689                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ote  Opitutus terrae
Pathway
ote00052  Galactose metabolism
ote00561  Glycerolipid metabolism
ote00600  Sphingolipid metabolism
ote01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Oter_2301
  Lipid metabolism
   00561 Glycerolipid metabolism
    Oter_2301
   00600 Sphingolipid metabolism
    Oter_2301
Enzymes [BR:ote01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Oter_2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Melibiase Melibiase_2_C
Motif
Other DBs
NCBI-ProteinID: ACB75583
UniProt: B1ZQH4
Position
2969450..2970649
Genome map
AA seq 399 aa AA seqDB search
MRKLLCVLLCVASSAFAQKWEGLALTPPMGWNSWNTFANHISEKVVRETADAMEKNGMRD
AGYVYIVIDDTWSLRQRDANGSLVADPEKFPSGMKALADYVHAKGFKLGIYSCAGKTTCG
GYPGSWGHEFQDARLWASWGIDYLKYDWCDHGDANAKDAYARMSAALRAAGRPVVFSLCE
WGQNRPWEWAEPIGHLWRTTGDIYDSYDGRKGWESGWKRLLDLQYSLVDSSGAYDGLNKF
AGPGHWNDPDMLEVGNDGLSLAESRAHFSFWCLLAAPLMAGNDVRHMSEEIRAIMTDKEV
IAINQDPAGKQGFRALAEPAKSIEIWVKELSNQEWAVCALNTDTSARELTIDWGRLWTIQ
GKHSVRDVWAKKAVGDTSKPYTVRVESHDVAMFRLTPAK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactgctttgtgtgctgctttgcgtcgccagctcggcgttcgcgcaaaagtgg
gagggcctcgcgctgacgccgcccatgggctggaacagctggaacaccttcgccaatcac
atcagcgaaaaggtcgtgcgcgagacggcggatgcgatggagaaaaacggcatgcgcgac
gccggctacgtttacatcgtcatcgatgacacgtggtcgttgcggcagcgcgacgctaac
ggcagcctggtcgcagatcccgaaaagtttcccagcggcatgaaggcgctggccgattac
gtgcacgcgaaaggattcaagctcggcatctacagttgtgcgggcaagacgacgtgcggc
ggttatccgggcagttggggccatgaatttcaggatgcgcggttgtgggcgtcatggggc
atcgactacctcaaatacgactggtgcgatcacggcgatgcgaacgcgaaggatgcctac
gcgcggatgagcgcggcgctgcgcgcggccgggcgtccggtggtgttcagcctctgcgaa
tggggccagaacaggccgtgggaatgggctgagcccatcggccatctgtggcgcacgacg
ggcgatatctacgactcctacgacggccggaagggttgggagtccggctggaagcgattg
ctcgacctgcagtattcgctggtcgacagctcgggcgcttacgatgggttgaacaagttc
gccggaccgggacactggaacgacccggacatgctcgaggtcggcaacgacgggctgtcg
ctggccgagtcgcgcgcgcatttcagcttctggtgcctgctcgccgcgccgctcatggcc
ggcaacgacgtgcggcacatgagcgaggagatccgcgcgatcatgaccgacaaggaggtg
atcgcgatcaaccaggatcccgcgggcaagcagggcttccgcgcgctggccgagccggcg
aaatccatcgagatctgggtgaaggagctgagcaaccaggagtgggcagtgtgcgcgctc
aacaccgacaccagcgcacgggagctcacgatcgattggggccggctctggacgatccag
ggcaagcacagcgtgcgcgacgtctgggcgaagaaagcggtgggcgacaccagcaagccc
tacaccgtgcgcgtcgagtcgcacgacgtggcgatgttccggctcacgccggcgaagtag

DBGET integrated database retrieval system