KEGG   Opitutus terrae: Oter_2895Help
Entry
Oter_2895         CDS       T00689                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ote  Opitutus terrae
Pathway
ote00010  Glycolysis / Gluconeogenesis
ote00052  Galactose metabolism
ote00500  Starch and sucrose metabolism
ote00520  Amino sugar and nucleotide sugar metabolism
ote00521  Streptomycin biosynthesis
ote01100  Metabolic pathways
ote01110  Biosynthesis of secondary metabolites
ote01120  Microbial metabolism in diverse environments
ote01130  Biosynthesis of antibiotics
ote01200  Carbon metabolism
Module
ote_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oter_2895
   00052 Galactose metabolism
    Oter_2895
   00500 Starch and sucrose metabolism
    Oter_2895
   00520 Amino sugar and nucleotide sugar metabolism
    Oter_2895
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Oter_2895
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Oter_2895
Enzymes [BR:ote01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Oter_2895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACB76176
UniProt: B1ZXC5
Position
complement(3696294..3697211)
Genome map
AA seq 305 aa AA seqDB search
MTSSLIGIDLGGTKCAVSIPDGDDGVREVARFASDKPAPTLARLFAEIDRLQPGDDVVFG
ISCGGPLDAERGLILSPPNLPGWDRIAICDQLTRRYGGDARLMNDANACALAEWQFGAGR
GTRNMIFLTMGTGMGAGLILDGRLYEGTNGNAGEVGHVRLVPTGPVGYGKPGSFEGFCSG
GGIAQLAHRFWPEALPDQLTAREAATAATLGDPVALRLWHEVGIRLGEALAILVDVLNPE
RIVIGSIFARCEQFIAGGMQESLRREALAPSLAVCSVVPAALGEQIGSHAALAIARCHLR
PVSTP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacttcatctctgattggcatcgatctcggcggcaccaaatgtgccgtgagcattccc
gatggcgacgacggcgtgcgcgaagtggcgcgcttcgcctcggacaaaccggccccgacg
ctcgcacggcttttcgccgagatcgaccggctgcagcccggcgacgacgtcgtgttcggc
atttcctgcggtggtccgctggacgccgagcgcggtctgatcctgtccccgccgaatctc
cccggatgggatcgcatcgcaatctgcgaccaactcacccgccgctacggcggcgatgcc
cgcctcatgaacgacgccaatgcctgcgcgctcgccgagtggcagttcggcgccggccgc
ggtacgcgcaacatgatcttcctcacgatgggcaccggcatgggcgcgggcctcatcctc
gacggacggctctacgaaggcacgaacggcaacgccggcgaagtgggccacgtgcgcctc
gtcccgaccgggccggtcggctacggcaagcccggctcattcgagggcttctgctccggc
ggcggcatcgcgcaactcgcgcaccgcttctggcccgaggccctgccggatcaactcacc
gcccgcgaggccgcgacggccgcgacgctcggcgatcccgtggcactccggctgtggcac
gaagtcggcatccgactcggcgaagcgctcgcgatcctcgtcgatgtactcaatcccgag
cgcatcgtcatcggcagtattttcgcgcgctgcgaacagttcatcgcaggcggcatgcag
gaatccctccgtcgcgaagccctcgccccgagcctcgccgtttgctccgtcgtccccgcc
gcgttgggcgagcagatcggcagccacgccgccctcgccatcgcccgttgtcacctccgc
cccgtttccaccccatga

DBGET integrated database retrieval system