KEGG   Opitutus terrae: Oter_4021Help
Entry
Oter_4021         CDS       T00689                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ote  Opitutus terrae
Pathway
ote00260  Glycine, serine and threonine metabolism
ote01100  Metabolic pathways
ote01110  Biosynthesis of secondary metabolites
ote01120  Microbial metabolism in diverse environments
ote01130  Biosynthesis of antibiotics
ote01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ote00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oter_4021
Enzymes [BR:ote01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Oter_4021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 IL11
Motif
Other DBs
NCBI-ProteinID: ACB77295
UniProt: B1ZZW2
Position
5216485..5217537
Genome map
AA seq 350 aa AA seqDB search
MCAATPAPNFTFGSDNTAGICPEAWAGLTEANAGCVASYGDDPFTTKAKARIRELFQTDC
EVFFVFNGTAANSLALAACCRSPFTRVICHDYSHIDTDECGAPELFTGGAKLTALSGPNG
KLQPAAVEGALHLGHGVHFPKPAALSLTQSTEWGTLYTADELRALTSLAHANGLAVHMDG
ARFANAVEASHLSPADLTWRAGVDVLSFGGTKNGMQTAEAVVFFNHDLARDFEYRVKQGG
QLASKMRYAGGQWLAMLRDGAWLRHAAHANAMARRLADAIRQIPSLQFIVEPQVNALFVE
MPPAVYAALTARGWQFYRFIGENGYRLMCSWATTEAEVDAFVADLRATAR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgctgcgactcccgccccgaacttcactttcggcagtgacaacaccgccggcatt
tgccccgaagcctgggccggattaacggaggcgaacgccggttgcgtcgccagctacggc
gacgatccgttcaccaccaaagccaaggcacggatccgagagctgttccaaaccgattgc
gaggtattcttcgtcttcaacggcaccgccgccaactcgctcgcgctcgccgcctgctgc
cgcagcccgttcacccgcgtgatctgccacgactactcgcacatcgacaccgacgagtgc
ggcgcgccggagctctttaccggcggggcgaaactgacggcgctgtccggtccaaacggc
aagctgcagcccgcggcagtggaaggtgcgctgcacctgggtcacggggtgcactttccg
aaacccgccgcgctctcgctcacgcaatcgaccgaatggggcacgctctataccgcggac
gagctccgcgcgctgacctcgctcgcgcacgccaacggactcgccgtgcacatggacggc
gcgcgtttcgcgaatgcggtcgaggcgtcgcacctctcgcccgccgatcttacctggcgt
gccggggtcgacgtgctgtcgttcggcggcaccaaaaacggcatgcaaaccgccgaggcc
gtcgtgtttttcaatcacgatctggcgcgagatttcgaataccgcgtcaaacagggcggc
cagctcgcctcgaaaatgcgttatgccggcggccagtggctcgcgatgctgcgcgatggc
gcctggctccggcatgcggcgcacgcgaatgcgatggcccgccggctcgccgacgcgatc
cgccagattccgtcgctgcagttcatcgtcgagccgcaggtgaacgcgctcttcgtcgaa
atgccgcccgcggtctacgccgcgctcacggcgcgcggctggcagttttatcgtttcatc
ggcgagaacggctatcggctgatgtgctcgtgggcgacaaccgaggccgaggtcgacgcg
ttcgtcgctgatctgcgcgcgacggcgcgatag

DBGET integrated database retrieval system