KEGG   Opitutus terrae: Oter_4233Help
Entry
Oter_4233         CDS       T00689                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ote  Opitutus terrae
Pathway
ote00020  Citrate cycle (TCA cycle)
ote00640  Propanoate metabolism
ote00660  C5-Branched dibasic acid metabolism
ote01100  Metabolic pathways
ote01110  Biosynthesis of secondary metabolites
ote01120  Microbial metabolism in diverse environments
ote01130  Biosynthesis of antibiotics
ote01200  Carbon metabolism
Module
ote_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ote_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Oter_4233
   00640 Propanoate metabolism
    Oter_4233
   00660 C5-Branched dibasic acid metabolism
    Oter_4233
Enzymes [BR:ote01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Oter_4233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ACB77506
UniProt: B1ZP17
Position
5458831..5460012
Genome map
AA seq 393 aa AA seqDB search
MNIHEYQAKALFEKFGVLVPKGAPAKTPEEFVTALAQLPEGMIVVKSQIHAGGRGKGTFT
DGFKGGVKVCKSKAEAREAAGKMLGNTLVTAQTGPAGRKVQTIYFNVGSQIKKEYYLAIL
LDRATSRPVIVASTEGGMEIEKVAHDTPDRIFKVHVDPAYGLADFQVRELVFKLGFTAAE
GKNASKLIRALYRCFWENDASMVEVNPLITTPDGQVEALDAKVAFDDNALFRHPELVELR
DLNEEDPKEIEASKHELNYIALDGNIACLVNGAGLAMSTMDIIKHFGGTPANFLDVGGGA
SREQVVAAFKIILGDKNVRGILVNIFGGIMDCNVIAQGIVDAVKEVGLELPLVVRLEGNN
VAAGKATLATSGLKLVSGDSMADAAQKIVKLVA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgagtatcaggcgaaagcgcttttcgaaaaattcggggttctggtcccg
aagggagcgccagccaagacgccggaagaatttgtcactgcgctcgcccaactccccgag
ggcatgatcgtggtcaaatcgcagatccacgccggcgggcgtggcaagggcacgtttacc
gacggcttcaagggcggcgtcaaggtctgcaagtccaaggccgaagcccgcgaggccgcc
ggcaaaatgctgggcaacacgctcgtcaccgcgcaaaccggccccgccggacgcaaggtc
cagacgatctacttcaatgtcggcagccagatcaaaaaggaatactacctcgcgatcctg
ctcgaccgcgcgacctcgcgcccggtgatcgtcgcctcgacggaaggcggcatggaaatc
gagaaggtggcgcatgacacgcccgatcggattttcaaggtccacgtcgatccggcctac
ggcctggccgacttccaggtgcgcgagctggtcttcaagctcgggttcacggccgcggaa
gggaagaacgcgagcaagctgattcgcgccctgtatcggtgcttctgggaaaacgatgcg
tcgatggtcgaggtcaacccgctcatcaccacgcccgacggccaggtcgaggcgctcgat
gcgaaggtcgccttcgacgacaacgcgctcttccggcatcccgaactcgtggaactccgt
gatctcaacgaggaggacccgaaggaaatcgaggcctcgaaacacgagctcaactacatc
gcgctcgacggcaacatcgcctgcctggtcaacggcgcgggcctggccatgagcacgatg
gacatcatcaagcatttcggcggcacgcccgcgaacttcctcgacgtcggcggcggcgcc
tcgcgcgaacaggtcgtcgctgcgttcaagatcattctcggcgacaaaaacgtccggggc
atcctcgtaaacatcttcggcggaatcatggactgcaacgtgatcgcgcagggcatcgtc
gatgccgtgaaggaagtcggcctcgaactgccgctggtcgtgcggctcgaggggaacaac
gtggcggcgggcaaggccaccctggccacgtccggcctgaagctcgtctccggcgactcg
atggccgacgccgcacagaaaatcgtgaagctggtcgcctag

DBGET integrated database retrieval system