KEGG   Opitutus terrae: Oter_4632Help
Entry
Oter_4632         CDS       T00689                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ote  Opitutus terrae
Pathway
ote00900  Terpenoid backbone biosynthesis
ote01100  Metabolic pathways
ote01110  Biosynthesis of secondary metabolites
ote01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Oter_4632
Enzymes [BR:ote01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Oter_4632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom GFO_IDH_MocA Semialdhyde_dh NAD_binding_3 DapB_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACB77902
UniProt: B2A0E8
Position
5952099..5953427
Genome map
AA seq 442 aa AA seqDB search
MGGTPMPRGTGAPPVGLQESAMRLRSNRPFNPALAAAAPFPAYSPAFVAAPSSNPRKRIV
LLGATGSIGENTLRVLAAHPDKLQLVGVAARANHPRLAQIARDFQVPHVGIFDEAAFAAA
KAADGFPAGTQLHRGPAGLVELARLAEADLVLVAVVGTTGLEPALAAVAAGKDLALASKE
ILVLAGKFVMAAARKQGVKLLPVDSEHNAVFQCLEGHPQAGVRRIILTASGGAFRDWPAE
RLAHVAPADALKHPNWAMGPKITVDSATLANKGLELIEAQWLFSLRPDQCTAVLHPQSIV
HCLVEFNDGALLAQLCPPSMTFPIQHALLYPARVPGVDSTLDFTKLLGLEFRPVDELRFP
CLRLARQTMVAGGVAPAVFNAANEIAVAAFLAEKIPFLAIPSVIDETLQRIDNFEPDSVS
AVLAADADARRFATAALKHFPR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgggcgggacgcccatgccacgtggcacgggcgccccccccgtgggtttgcaggaaagt
gcgatgcgactccgctccaatcgccccttcaaccccgcgcttgccgccgctgcgccgttt
cccgcatactcgccagctttcgtggctgcaccgtcctccaaccctcgcaaacgcatcgtc
ctgctcggtgcgaccggttccatcggcgagaacaccttgcgcgtcctcgcggcacatccg
gacaagctgcagctcgtaggcgtcgccgcgcgcgccaatcacccccggctcgcccagatc
gcccgcgatttccaggtgccgcacgtgggcattttcgacgaagcggcgttcgccgccgcc
aaagcggcagacggtttccccgccggcacgcaactgcaccgcggtcccgccggactcgtg
gaactcgcccgactcgccgaagccgatctcgtcctcgtggccgtcgtcggcaccaccggg
ctcgaacccgctctcgccgccgtggccgcgggcaaggatctcgcgctcgcgtcgaaggaa
atcctcgtgcttgcgggcaagttcgtcatggcggccgcgcgcaagcagggggtgaagctc
ctgcccgtcgacagcgagcacaacgccgttttccagtgcctcgagggtcacccgcaggcc
ggcgtgcgccggatcatcctgacggccagcggcggcgcgttccgcgactggccggccgag
cggctcgcgcacgtggcacccgccgatgcgttgaaacatccgaactgggcgatgggtccg
aagatcaccgtcgactccgccacgctcgcgaacaagggcctcgaactcatcgaggcgcag
tggctgttctcgctgcggccggaccagtgcacggccgtactgcacccgcaaagcatcgtg
cactgcctggtcgagttcaacgatggcgccctgctcgcccagctctgcccgccgtcgatg
acgtttccgatccagcacgcgctgctgtaccccgcgcgggtgccgggcgtggactcgacg
ctggatttcaccaagctgctcggactcgagttccgaccggtcgacgagctccgcttccct
tgcctgcgactcgcccgccagacgatggtcgccggcggcgtcgcgcccgcggtcttcaac
gccgcgaacgagatcgccgtcgctgcgttcctcgcggaaaagattccgttccttgcgatt
ccatcggtgatcgatgaaactctgcaacgcatcgacaacttcgaacccgactccgtttcc
gccgtcctggccgcggacgccgacgcccggcgcttcgcgaccgccgccctcaagcatttt
ccccgctag

DBGET integrated database retrieval system