KEGG   Ottowia oryzae: C6570_03855Help
Entry
C6570_03855       CDS       T05363                                 

Definition
(GenBank) acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
otk  Ottowia oryzae
Brite
KEGG Orthology (KO) [BR:otk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C6570_03855
Enzymes [BR:otk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     C6570_03855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AVO33482
UniProt: A0A2S0MC56
Position
829225..830046
Genome map
AA seq 273 aa AA seqDB search
MKLAAIQMVSCTSVADNLRAAHALLSEAARGGAELAVLPEYFCVMGRQDTDKLALQEALG
GGPIQDWLAATARELDLWIVGGTLPLSREPADPRRVRNASLAFAPSGERVACYDKIHLFR
FDDGTRVYDEAAVLAAGRTPTLFDLPSRDGHTWKVGMSVCYDLRFPELYRAYAAQGADLL
LVPSAFTHVTGMAHWEVLLRARAIENLCGVVAAAQGGLHENGRRTWGHSMVVDAWGQVLN
SRAEGAGVVLAELLPAELAARRAQLPALSHRVL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgcggcgattcaaatggtgtcgtgcacctcggtggccgacaatctgcgcgcg
gcccacgccttgttgagcgaagcggcccgcggcggggccgaactggccgtgctgcccgaa
tatttctgcgtgatgggccgccaggacaccgacaagctggccctgcaagaggcgctgggc
ggcgggcccattcaggactggctggcggccaccgcgcgcgaactcgacctgtggatcgtc
ggcggcacgctgccgctgtcgcgcgagcccgccgacccgcgccgtgtgcgcaacgcctcg
ctggcctttgcaccgagtggcgagcgcgtcgcctgctacgacaagatccacctgttccgc
tttgacgacggcactcgcgtgtacgacgaagccgccgtgctggccgccgggcgcacgccg
acgctgttcgatctgccctctcgcgacggccacacctggaaggtgggcatgagcgtgtgc
tacgacctgcgctttcccgagctgtaccgcgcctacgccgcgcagggcgccgatcttctc
ttggtgcccagcgccttcacccacgtcaccggcatggcgcattgggaggtgctgctgcgc
gcgcgcgccattgaaaacctctgcggcgtggtggccgccgcgcaaggcggcctgcacgag
aacggccgtcgcacctggggccacagcatggtggtggatgcctggggccaggtgctgaac
agccgtgccgaaggcgcgggcgtggtgctggctgagctgctgccggctgagctggccgcg
cgccgcgcgcagctgccggccctgtcgcaccgcgtgctctga

DBGET integrated database retrieval system