KEGG   Ottowia oryzae: C6570_07705Help
Entry
C6570_07705       CDS       T05363                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
otk  Ottowia oryzae
Pathway
otk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:otk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C6570_07705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:otk02022]
    C6570_07705
Two-component system [BR:otk02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   C6570_07705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C Phage_TAC_6 OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AVO34139
UniProt: A0A2S0ME27
Position
complement(1651324..1652055)
Genome map
AA seq 243 aa AA seqDB search
MNQAINRADKIVVVDDDARIRDLLRRYLAQEGFEVIVAEDAKALARIMLRDTIDLIVLDL
MMPGEDGLSVCRRLRAAGDKTPIIMLTAKGEDVDRIVGLEVGADDYLGKPFNPRELLARV
HAVLRRRPPQEAPGAPSAENESVSFGPFVFDLAARSLHKSGEEISLTTGEFAMLKALVRH
PRQPLSREKLAQLARGREFEPFDRSLDVQISRLRKLIEQDAASPRYIQTVWGVGYVFVPD
GTS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggcaatcaaccgagccgacaagatcgtcgtcgtggacgatgacgcccgcatc
cgggatctgctgcgccgatatctggcgcaagaaggtttcgaggtgatcgtggccgaagac
gccaaggccctggcgcgcatcatgctgcgcgacaccatcgacctcatcgtgctggatttg
atgatgcctggtgaagacggcctgtcggtgtgccgccgcctgcgcgccgcgggcgacaaa
acgcccatcatcatgctgactgccaagggcgaggatgtggaccgcatcgtcggcctggaa
gtgggcgccgacgactacctgggcaagcccttcaacccgcgcgagctgctggcgcgcgtg
cacgccgtgctgcgccgccgcccgcctcaagaagccccgggcgcgccgtcggccgaaaac
gaatcggtcagctttggccccttcgtgttcgacctggcagcgcgttcgctgcacaagagc
ggcgaggaaatctcgctgaccacgggcgaattcgccatgctgaaggcgctggtgcgccac
ccgcgccagccgctgtcgcgcgagaagctggcccagctggcgcgcggccgcgagtttgag
cccttcgaccgcagcctggacgtgcagatctcgcgcctgcgcaagctgatcgagcaggac
gccgccagcccccgctacatccagaccgtgtggggcgtgggctacgttttcgtgccggac
ggcaccagctga

DBGET integrated database retrieval system