KEGG   Octadecabacter temperatus: OSB_02240Help
Entry
OSB_02240         CDS       T04001                                 

Gene name
pckA
Definition
(GenBank) Phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
otm  Octadecabacter temperatus
Pathway
otm00010  Glycolysis / Gluconeogenesis
otm00020  Citrate cycle (TCA cycle)
otm00620  Pyruvate metabolism
otm01100  Metabolic pathways
otm01110  Biosynthesis of secondary metabolites
otm01120  Microbial metabolism in diverse environments
otm01130  Biosynthesis of antibiotics
otm01200  Carbon metabolism
Module
otm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:otm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OSB_02240 (pckA)
   00020 Citrate cycle (TCA cycle)
    OSB_02240 (pckA)
   00620 Pyruvate metabolism
    OSB_02240 (pckA)
Enzymes [BR:otm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     OSB_02240 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: AKS44793
UniProt: A0A0K0Y1H5
Position
complement(201321..202919)
Genome map
AA seq 532 aa AA seqDB search
MDHGTVNPSMKLPDQGINGLGQVYYNYSEDDLIAEALKRDEGQLGKGGAFLVTTGKFTGR
SPKDKHVVRSATTEHTIWWENNAAMEPAAFDQLYDDMIAHMGGKDYFVQDLFGGADPAHR
LDVRFVTEMAWHGLFIRHLMRRPEASELPGFTPDWTVINCPSFLADPARHGCRSETVITM
NFDRKIILIAGTEYAGENKKSIFTLLNYLLPEKDIMPMHCSANHAKDNPVDSAVFFGLSG
TGKTTLSADPNRTLIGDDEHGWSDRGIFNFEGGCYAKTIGLNPEAEPEIYATTEMSGTVI
ENMVFDPETLELDFEDDSLTANMRCAYPLNYISNASETALGGHPKNIIMLTCDAFGVLPP
IARLSPAQAMYHFLSGFTSKVAGTERGVTEPEPTFSTCFGAPFMPRRPEVYGNLLRSKIA
THGATCWLVNTGWTGGAYGTGNRMPIKATRALLTSALNGTLVEGQFRKDANFGFDVPVAC
LGVDDVLLNPRDTWADSAAYDAQASKLVDMFADNFEQYLPFIDEDVKAAAIG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaccacggcacggtcaacccatccatgaagctgcctgatcaaggcatcaacgggttg
ggtcaggtctattataactactccgaagacgacctgattgccgaagcgttgaagcgtgac
gaaggccagcttggtaaaggcggcgcgtttctcgtgacaacggggaagttcacgggtcgt
tcaccaaaggacaaacacgttgttcgcagcgcaacgactgaacacaccatctggtgggaa
aacaacgctgcgatggaacctgctgcgtttgaccagctttatgacgacatgatcgcgcac
atgggtggcaaagactacttcgtgcaagatttgtttggtggcgctgacccagcgcaccgc
ttggacgttcgcttcgtcactgaaatggcgtggcacggtctgttcatccgtcacttgatg
cgtcgccctgaggcgtccgagcttcctggcttcacgccggattggacggtcatcaactgc
ccaagtttccttgcggacccagcacgtcacggatgccgttctgaaacggtcatcacgatg
aacttcgaccgcaaaataatcctgatcgcaggcaccgagtacgcaggcgagaacaagaaa
tcgattttcacgctgctgaactacttgctgcctgaaaaagacatcatgccgatgcactgt
tcggccaaccacgccaaagacaaccctgtcgacagcgctgtgttctttggcctgtccggc
accggcaaaacaacactgtccgctgacccgaaccgcacattgatcggcgacgatgagcat
ggttggtcagatcgcggtatcttcaactttgagggcggctgttacgctaaaaccatcggt
ctgaaccctgaagccgagcctgaaatctacgcgacaactgagatgagcggcactgtgatc
gaaaacatggtgttcgatccagaaacgctggagctcgactttgaagacgacagtctgaca
gcgaacatgcgttgtgcatacccgctgaattacatctccaacgcgtctgaaacagcgctt
ggtggtcaccctaagaatatcatcatgctgacgtgtgatgcctttggtgtccttcctccg
attgcgcgtcttagcccagcgcaggcaatgtaccacttcctgagcggtttcacgtccaag
gttgcaggtactgagcgcggtgttaccgagcctgagccgacgttttcaacctgtttcggt
gcgccgttcatgccgcgccgtcctgaggtctacggcaacttgctgcgctccaagatagcg
acgcatggcgcaacatgctggctggtgaataccggctggacgggtggtgcttacggcacg
ggcaaccgtatgccgatcaaagcgacacgtgctttgctgacgtctgcgctgaacgggact
ttggtcgaaggccaattccgcaaggatgcgaacttcggttttgatgtgcctgtggcttgc
ctcggtgtggatgacgttcttctgaacccacgcgacacatgggcggatagcgctgcgtat
gacgcacaggcgtcaaagcttgttgatatgtttgcagataactttgaacagtaccttccg
ttcattgatgaggatgtcaaagctgctgcaatcggctaa

DBGET integrated database retrieval system