KEGG   Octadecabacter temperatus: OSB_05210Help
Entry
OSB_05210         CDS       T04001                                 

Gene name
mlhB
Definition
(GenBank) Monoterpene epsilon-lactone hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
otm  Octadecabacter temperatus
Pathway
otm00903  Limonene and pinene degradation
otm00930  Caprolactam degradation
otm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:otm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OSB_05210 (mlhB)
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    OSB_05210 (mlhB)
Enzymes [BR:otm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     OSB_05210 (mlhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 DUF3089 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: AKS45084
UniProt: A0A0K0Y2C8
Position
478394..479284
Genome map
AA seq 296 aa AA seqDB search
MSSPSLRLRLLIFGMRWLVKPKLKRTGTPEKANRDFERAAPFLFSKPKGLKAVQDGPSSR
ITVGTPMADRAILFLHGGAFVTGSQRSYRAFGGRLAKRTKATIFLANYPVLQDAPFPAAP
NAVLNAWNHLIASGWKAHQIVIAGDSAGGNLVFGLLSTLLARNERPAAVLAFSPWTDLTL
SGDTIETNRDKDPLIPVSRMEEAVDLYLNGADTMHPLASPLFAGFKNPPPVLIQVGGDEV
LLSDSKRMAEATGGAVDVWPYVPHVWQIFDGRLPEANAAMRKAAAFVQSSFESAKR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaccgtctctgcgactacgtttgctgatctttggcatgcgatggttggtcaag
cccaagttaaagcgcaccggaacccctgaaaaggcaaaccgcgatttcgagcgagctgca
ccgtttttgttcagcaaacctaaagggttgaaagcggtccaagatggcccctcaagccga
ataaccgtcggaacaccgatggcggaccgcgcgattttgttcctacatggaggcgcattc
gtgacagggtctcagcgcagttaccgtgcgtttggcggtcgattggcgaagcgtacaaaa
gctacgatttttttggccaactatccggtccttcaggacgcgccgtttccagcagcaccg
aatgcagtactcaacgcatggaaccatttgatcgcatccggatggaaagcacatcagatc
gttatcgcaggggacagcgccggtgggaatttagttttcgggttactgtcgacccttttg
gcccgtaacgaacgccccgccgcggttctcgccttttcgccttggacggatttaacattg
tccggtgacacgattgagacaaaccgcgacaaagacccgttaatccctgtgagccggatg
gaagaagccgtcgatctgtatttgaatggcgcggacacgatgcacccgcttgccagcccg
ctttttgcgggcttcaaaaaccctccgccggttttgatacaagttggtggagacgaagtt
ttactgagtgattccaagagaatggctgaagcaactggtggagcggttgatgtctggccg
tacgtcccgcacgtctggcagatttttgatggccgcctacctgaggccaacgctgcgatg
cgaaaagcggcggcgtttgttcaaagctcctttgaaagcgccaaacgatag

DBGET integrated database retrieval system