KEGG   Octadecabacter temperatus: OSB_15210Help
Entry
OSB_15210         CDS       T04001                                 

Gene name
arcA
Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
otm  Octadecabacter temperatus
Pathway
otm00220  Arginine biosynthesis
otm00330  Arginine and proline metabolism
otm01100  Metabolic pathways
otm01110  Biosynthesis of secondary metabolites
otm01130  Biosynthesis of antibiotics
otm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:otm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    OSB_15210 (arcA)
   00330 Arginine and proline metabolism
    OSB_15210 (arcA)
Enzymes [BR:otm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     OSB_15210 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AKS46072
UniProt: A0A0K0Y5G0
Position
1493153..1494076
Genome map
AA seq 307 aa AA seqDB search
MTPQDILLIGAPVDSGKDRKGCIMGPDAYRTARLAETLVELGHNVSDLGNLTAENTDISE
HDHLVALPQTVGWTRTLQEAAKDAAPKGLPIFLGGDHSLALGTVTGIADHAADVGRPLFV
LWLDAHSDFHTPQSTASGNLHGTPTAYFTGRTGFDAFPAVNNPVPTENVCMIGLRSVDPA
EHAALADTNVSIADMRAIDEGGIRAPLAEFLAKVEAANGLLHVSLDVDFLDPDIAPAVGT
TVPGGATLREAHLVMEMLHDSQRVTSLDLVELNPFMDERGKTASLMVDLTASLMGRRVFD
RPTRAFT
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccccacaagacattcttctcatcggcgcccctgtagacagcggtaaagaccgcaaa
gggtgcataatggggccagacgcttaccgcaccgcccgccttgccgagactttggttgaa
ctgggtcacaatgtttctgacttaggcaaccttaccgccgaaaacacggacatttcggaa
catgaccacctcgtcgccctgccccaaaccgtcggctggacgcgcacattgcaagaggcc
gcaaaagacgcagctccaaagggtttgccgattttcttaggtggtgatcactctctcgca
ctcggcacggtcacaggtattgccgatcacgcggccgacgttgggcgaccgcttttcgtg
ctttggctcgatgcccacagcgattttcacacgccacaatccaccgcctctggcaatctc
cacggcacgccaactgcttatttcacggggcgcacaggctttgacgcctttcccgcggtc
aacaatcccgttccaacagaaaacgtctgcatgatcggcctacgttccgttgaccccgcc
gaacacgcagccctcgccgatacgaacgttagcatcgccgacatgcgcgcaatcgacgaa
ggcggcattcgcgcgccattggccgaattccttgccaaagttgaggccgccaatggccta
cttcatgtctctctcgatgtcgatttcctcgaccccgacattgcgcccgcagttggcaca
actgtcccaggtggcgcgaccctacgcgaagcccacctcgtgatggaaatgctacacgac
agccagcgcgtcacctccctcgatttggtcgaacttaaccccttcatggatgagcgcggc
aaaaccgcctctttgatggttgatctcacagcctcgctcatgggccgccgcgtctttgac
cgtccaacccgcgcctttacctaa

DBGET integrated database retrieval system