KEGG   Octadecabacter temperatus: OSB_22780Help
Entry
OSB_22780         CDS       T04001                                 

Gene name
fadA_1
Definition
(GenBank) Putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
otm  Octadecabacter temperatus
Pathway
otm00071  Fatty acid degradation
otm00072  Synthesis and degradation of ketone bodies
otm00280  Valine, leucine and isoleucine degradation
otm00310  Lysine degradation
otm00362  Benzoate degradation
otm00380  Tryptophan metabolism
otm00620  Pyruvate metabolism
otm00630  Glyoxylate and dicarboxylate metabolism
otm00640  Propanoate metabolism
otm00650  Butanoate metabolism
otm00900  Terpenoid backbone biosynthesis
otm01100  Metabolic pathways
otm01110  Biosynthesis of secondary metabolites
otm01120  Microbial metabolism in diverse environments
otm01130  Biosynthesis of antibiotics
otm01200  Carbon metabolism
otm01212  Fatty acid metabolism
otm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:otm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OSB_22780 (fadA_1)
   00630 Glyoxylate and dicarboxylate metabolism
    OSB_22780 (fadA_1)
   00640 Propanoate metabolism
    OSB_22780 (fadA_1)
   00650 Butanoate metabolism
    OSB_22780 (fadA_1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OSB_22780 (fadA_1)
   00072 Synthesis and degradation of ketone bodies
    OSB_22780 (fadA_1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OSB_22780 (fadA_1)
   00310 Lysine degradation
    OSB_22780 (fadA_1)
   00380 Tryptophan metabolism
    OSB_22780 (fadA_1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OSB_22780 (fadA_1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OSB_22780 (fadA_1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OSB_22780 (fadA_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otm04147]
    OSB_22780 (fadA_1)
Enzymes [BR:otm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OSB_22780 (fadA_1)
Exosome [BR:otm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OSB_22780 (fadA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKS46814
UniProt: A0A0K0Y768
Position
2227659..2228870
Genome map
AA seq 403 aa AA seqDB search
MTDAYIYDAIRTPRGKGRKDGSLHEVTSAKLSAGVLNALKERNNLEGHAVEDVIWGNVTQ
VKEAGGCLARTAVLASDLDQSIPGLAINRFCASGMEAVNLAANQIQGGAGEAYIAGGVEM
MGRVPMGSDGAAIAVDPSIAMNTYFVPQGISADIIATEYGFSRDDADALAVASQQRAEAA
WKDNRFANSIVPVKDQNGLNILDHDEYMRPQTDMQSLGGLNAAFQAMGEVMPGFDKVALM
KYPHLERINHIHTAGNSSGIVDGSAGVLVGSKEFGEKFGLKPRARIRQTAKIGTDPTIML
TGPVPVTHKILADSGMSISDIDLFEVNEAFSSVVLRFMQAFDVDHSKVNVNGGSIAMGHP
LGATGAIIIGTLLDELERSDKEVGLATLCIASGMGAATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcatatatttacgacgcgatccgcacgccgcgcggcaaaggccgcaaggat
ggatcgctgcatgaagtgacatctgcaaaactgtctgctggcgttttgaacgctctgaaa
gaacgcaacaaccttgaaggccacgccgttgaggacgtgatttggggcaatgttacgcaa
gttaaagaagcgggtgggtgtttggcacgcaccgccgtgctggcgtctgatctggaccaa
tccattcctggccttgcgatcaaccgcttttgcgcgtccggcatggaagctgtgaacctc
gcggcgaaccaaattcaaggcggcgcaggcgaggcctacatcgcgggcggcgttgagatg
atgggccgcgtgccgatgggatccgacggggcagcgattgccgttgacccaagcatcgcg
atgaacacatacttcgttccacagggcatttcagccgacattatcgcgactgagtatggg
tttagccgcgatgacgcggatgcgctcgcggtggcgtcccaacagcgggcagaggctgcg
tggaaagacaaccgttttgccaactctatcgtgccggttaaggaccagaacggtctgaac
attttggaccatgacgaatacatgcggccacaaaccgacatgcaaagccttggcggcttg
aacgcagccttccaagcgatgggcgaagtcatgcccggttttgataaggtcgcattgatg
aagtacccgcaccttgagcggatcaaccacatccacacggcaggtaactcttccggtatc
gttgatggatctgcgggtgttcttgttggctctaaggagttcggtgagaaatttggtttg
aaaccacgcgcacgtatccgtcagacagcgaaaatcgggaccgacccgacaatcatgctg
acggggcccgttcctgtgacgcataaaatccttgccgatagcggcatgagcatatccgat
attgatctttttgaagtaaacgaggcgttttcctctgttgttttgcgcttcatgcaggcg
ttcgatgttgaccattcaaaggtcaacgtgaacggcggctccatcgcgatgggccacccg
ctgggtgcaacgggcgcgatcatcatcggcacccttttggatgagctggaacgctctgac
aaagaagtcgggcttgctacgctgtgcattgcatccggcatgggtgcagcaactatcatc
gaacgcgtttaa

DBGET integrated database retrieval system