KEGG   Octadecabacter temperatus: OSB_27070Help
Entry
OSB_27070         CDS       T04001                                 

Gene name
aldA
Definition
(GenBank) Putative aldehyde dehydrogenase AldA
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
otm  Octadecabacter temperatus
Pathway
otm00010  Glycolysis / Gluconeogenesis
otm00053  Ascorbate and aldarate metabolism
otm00071  Fatty acid degradation
otm00280  Valine, leucine and isoleucine degradation
otm00310  Lysine degradation
otm00330  Arginine and proline metabolism
otm00340  Histidine metabolism
otm00380  Tryptophan metabolism
otm00410  beta-Alanine metabolism
otm00561  Glycerolipid metabolism
otm00620  Pyruvate metabolism
otm00625  Chloroalkane and chloroalkene degradation
otm00903  Limonene and pinene degradation
otm01100  Metabolic pathways
otm01110  Biosynthesis of secondary metabolites
otm01120  Microbial metabolism in diverse environments
otm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:otm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OSB_27070 (aldA)
   00053 Ascorbate and aldarate metabolism
    OSB_27070 (aldA)
   00620 Pyruvate metabolism
    OSB_27070 (aldA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OSB_27070 (aldA)
   00561 Glycerolipid metabolism
    OSB_27070 (aldA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OSB_27070 (aldA)
   00310 Lysine degradation
    OSB_27070 (aldA)
   00330 Arginine and proline metabolism
    OSB_27070 (aldA)
   00340 Histidine metabolism
    OSB_27070 (aldA)
   00380 Tryptophan metabolism
    OSB_27070 (aldA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OSB_27070 (aldA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OSB_27070 (aldA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OSB_27070 (aldA)
Enzymes [BR:otm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     OSB_27070 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AKS47231
UniProt: A0A0K0Y8L8
Position
2660303..2662621
Genome map
AA seq 772 aa AA seqDB search
MTVKDIFESMDYGPAPESASETLEWLADRGGIAGHYINGQWGPLRDDFASTNPATGAKLA
GVTKGTADEVAKAVAAARKAQPKWAKDGAARARVLYAIARLMQKNSRLLAVMETLDNGKP
IRESRDIDVPLAIRHFYHHAGFAQLMDEEMPNAEPLGVCGQIIPWNFPLLMLAWKIAPAL
AMGNTVVLKPAEYTSLSAMVFCEICTAAGVPPGVINIVTGDGETGAALVDADVDKIAFTG
STAVGRIIREQTAGSGKALSLELGGKSPYIVFDDADIDSAVEGLVDAIWFNQGQVCCAGS
RLLVQEGIADRFYAKLRARMDGLRIGDPMDKCMDMGAIADVVQLEQIKAIVAANTSGEMY
QCAAPEGCFYPPTLITGMSPADTLMQEEIFGPVLVACTFRTPAEAVEIANNTRYGLAASV
WTENVNLALDIAPKLVSGIVWLNATNLMDAAAGFGGVRESGFGREGGWEGLQGYTKPKGK
TSKVTAPTAFTTTDGTPADPLDRTAKLYIGGKQARPDSGYSEPVFNKSGKLLGHASLANR
KDLRNAVEANAAATGWSKSTGHLRAQILYYIGENLSARADEFATRINQLTGGKSGTKEVD
DAIQHLFTWAAWADKYDGAAKGVPIRGVALAMNEPVGNIAVLTDDTRPLMGLIEPLAPAL
AMGNRVTAVASQAFPLAATDFYQVLETSDVPAGVANILTGRHTDLAPHMAAHANIDAVWS
FSTSDVSKVIEAKSAANLKRTWVNNATQRAWPSSTWRAQSTEVKTIWIPYGE
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaaagacatcttcgaatccatggactacggccctgcccctgaaagcgcatcg
gaaacgctcgaatggttagcggatcgtggcggcattgcaggccactacatcaacgggcaa
tggggcccactacgcgatgactttgcatccaccaaccccgcgacaggcgcgaagctcgca
ggtgtcaccaaaggcaccgcggatgaagtcgccaaggctgtcgcagccgcacgcaaagcc
caacccaagtgggcgaaagacggtgcagcgcgtgcgcgtgtcctctatgcaattgcccgc
ttgatgcagaagaattcgcgcctgttggccgtgatggaaaccctcgacaacggcaagccg
atccgcgaaagccgcgacatcgacgtgccactcgccatccgccatttctatcaccacgcg
ggctttgcccagctgatggacgaggaaatgccaaacgccgaacccctcggcgtgtgtggg
caaattattccgtggaacttcccgctgctgatgctcgcttggaaaatcgcgcccgcactg
gcgatgggcaacactgttgttcttaaacccgccgaatacacctccctgtccgcaatggtg
ttctgtgaaatctgtacagccgcaggtgttccgcctggcgttatcaacattgtcactggt
gacggcgaaacaggtgccgcgctggtcgacgcagacgtcgacaaaatcgctttcactggc
tcaactgccgtcggccgcattatccgcgaacaaactgcgggttcgggaaaagcgctttcc
ttggaattgggcggcaagtccccctacatagtgtttgacgacgctgacatcgattccgcc
gtagaaggtttggtcgacgccatctggttcaaccaaggccaagtttgctgtgcgggatcg
cgcctactggtccaagaaggtatcgctgatcgtttctacgccaaactacgcgcccgaatg
gacgggcttcgcattggcgatccgatggacaagtgcatggatatgggtgcgattgctgac
gttgtgcagcttgagcaaatcaaagccatcgtcgccgcgaacacatccggcgagatgtac
caatgcgcggcccctgagggctgcttctacccaccaacgttgatcacaggaatgtcgccc
gccgacacgctgatgcaggaagaaatctttggccccgttctggtcgcctgcaccttccga
acccctgccgaggccgtggaaatcgctaacaacacccgctacgggctggcagcatccgtg
tggacggaaaacgtgaacctcgcgctggatatcgcgcccaagttggtcagcggcatcgtc
tggttaaacgccacaaacctcatggatgctgctgccggtttcggcggcgtgcgcgagtct
ggcttcgggcgtgaaggcgggtgggaaggcttgcaaggctacaccaaacccaaaggcaag
acctcaaaggtgaccgccccaacagctttcaccaccacagacggcacgcctgccgatccg
ctggatcgcaccgcaaaactctacatcggcggcaaacaagcccgcccagatagtggctac
tctgagcccgttttcaacaaatccggcaagctgttgggccacgcaagccttgcgaaccgc
aaagacctacgtaacgcggttgaagccaatgccgctgcaacaggttggtctaaatccaca
ggccacctgcgcgcgcagatcctgtattacatcggtgagaacctgtccgcccgcgcggat
gagttcgcaacccgcatcaaccaactgacgggcggcaagtccggtacaaaagaagtcgat
gacgccatccagcatctgttcacatgggctgcatgggccgacaaatacgacggcgcagct
aagggtgtaccgatccgtggtgtcgccttggcgatgaacgaacctgtcggaaacatcgcc
gttctaacagacgacacgcgcccgcttatgggcctgatcgaaccgctggcgcccgcattg
gcaatgggaaaccgcgtcaccgccgtcgcctcgcaggctttcccactggccgcgacagat
ttctaccaagtgctcgaaacctcggacgtgcccgctggtgtcgccaacatccttacaggc
cgtcacacagacctcgcgccccatatggcggcccacgccaacatcgacgccgtctggtcc
ttctcgacctccgatgtctcaaaggtcatcgaagcaaaatctgccgctaacctcaaacgc
acttgggtcaacaacgcgacgcaacgtgcatggccctctagcacatggcgcgcccagtcc
accgaagtcaaaacgatctggattccttacggcgagtaa

DBGET integrated database retrieval system