KEGG   Ottowia sp. oral taxon 894: ADJ79_05455Help
Entry
ADJ79_05455       CDS       T04031                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oto  Ottowia sp. oral taxon 894
Pathway
oto00071  Fatty acid degradation
oto00072  Synthesis and degradation of ketone bodies
oto00280  Valine, leucine and isoleucine degradation
oto00310  Lysine degradation
oto00362  Benzoate degradation
oto00380  Tryptophan metabolism
oto00620  Pyruvate metabolism
oto00630  Glyoxylate and dicarboxylate metabolism
oto00640  Propanoate metabolism
oto00650  Butanoate metabolism
oto00900  Terpenoid backbone biosynthesis
oto01100  Metabolic pathways
oto01110  Biosynthesis of secondary metabolites
oto01120  Microbial metabolism in diverse environments
oto01130  Biosynthesis of antibiotics
oto01200  Carbon metabolism
oto01212  Fatty acid metabolism
oto02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ADJ79_05455
   00630 Glyoxylate and dicarboxylate metabolism
    ADJ79_05455
   00640 Propanoate metabolism
    ADJ79_05455
   00650 Butanoate metabolism
    ADJ79_05455
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ADJ79_05455
   00072 Synthesis and degradation of ketone bodies
    ADJ79_05455
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ADJ79_05455
   00310 Lysine degradation
    ADJ79_05455
   00380 Tryptophan metabolism
    ADJ79_05455
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ADJ79_05455
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ADJ79_05455
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ADJ79_05455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oto04147]
    ADJ79_05455
Enzymes [BR:oto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ADJ79_05455
Exosome [BR:oto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ADJ79_05455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKU66805
UniProt: A0A0K1NCK0
Position
complement(1291566..1292747)
Genome map
AA seq 393 aa AA seqDB search
MSETIVIVSATRTPMGSFQGDFTPLSANELGGVAIKAAVEKAGLQPQQVDEVIFGNVLTA
GQGQAPARQAAIKAGLPISTGAATLNKVCGSAMKAVMLAADAIKAGSASVVVAGGMESMT
NAPYLLKKARGGYRLGHDKIYDHMMLDGLEDAYEEGRSMGLFGEDCAAKYNFTRQMQDDF
AMASVQRAQSAIASGAFKEEITPVTIKDRKGERVVDTDEGPGRIKPEKIPTLKPAFKKDG
TVTAAASSSINDGAAAVVLMTESRAKELGCKPLARIVSYATHSQEPGWFTTAPVQASEKA
LKKAGWQVGDVDLWEVNEAFAVVPMALMHELKVPHDKVNVNGGACALGHPIGASGARIIV
TLLYALKKRGLKKGLATLCIGGGEGTAMALELL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaccatcgtcatcgtttccgccacccgcaccccgatggggagcttccagggc
gacttcactccgctgtccgccaacgaactgggcggcgtggccatcaaggctgccgttgaa
aaagcggggctgcagccgcagcaagtcgatgaagtcatcttcggcaatgtgctcaccgcc
ggccaggggcaagcgcccgcacggcaagccgccatcaaggccgggctgcccatctccacg
ggcgcggccacgctcaacaaggtttgcggctcggccatgaaggccgtcatgctggccgct
gacgccatcaaggcaggctctgccagcgtggtggtggctggcggcatggaaagcatgacc
aacgcgccctacctgctcaaaaaagcccgcggcggctaccgcctgggccacgacaagatt
tatgaccacatgatgctcgatggcctggaagacgcttacgaagaaggtcgcagcatgggc
ctgttcggcgaagactgtgccgccaagtacaacttcacgcggcaaatgcaggatgacttc
gccatggccagcgtgcagcgcgcgcaaagcgccatcgcctcgggcgcgttcaaggaagaa
atcacccccgtcaccatcaaagaccgcaaaggcgagcgcgtggtggacaccgatgaaggc
ccgggccgcatcaagcccgaaaaaatccccaccctcaagcccgccttcaaaaaagacggc
accgtcaccgccgccgccagctccagcatcaatgacggcgcagccgccgtggtgctcatg
accgaaagccgtgccaaggagttgggctgcaagccgctggcgcgcatcgtcagctacgcc
acgcactcgcaagagccgggctggttcaccaccgcccccgtgcaagccagcgaaaaggcg
ctgaaaaaagccggctggcaagtgggcgatgtggatctgtgggaagtcaacgaagccttc
gccgtggtgcccatggcgctgatgcacgagctgaaagtgccgcatgacaaagtgaacgtc
aacggcggcgcttgtgcgctgggccacccgattggcgccagcggcgcgcgcatcatcgtc
acgctgctttatgcgctgaaaaagcgcggcctgaaaaaaggcctggccacgctgtgcatc
ggcggcggcgaaggcacggccatggcgctggaactgctgtaa

DBGET integrated database retrieval system