KEGG   Ottowia sp. oral taxon 894: ADJ79_06090Help
Entry
ADJ79_06090       CDS       T04031                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
oto  Ottowia sp. oral taxon 894
Pathway
oto00450  Selenocompound metabolism
oto00970  Aminoacyl-tRNA biosynthesis
oto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oto00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ADJ79_06090
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ADJ79_06090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:oto01007]
    ADJ79_06090
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oto03016]
    ADJ79_06090
Enzymes [BR:oto01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ADJ79_06090
Amino acid related enzymes [BR:oto01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ADJ79_06090
Transfer RNA biogenesis [BR:oto03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ADJ79_06090
 Prokaryotic type
   Other AARSs
    ADJ79_06090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AKU66899
UniProt: A0A0K1NCU0
Position
complement(1422255..1424351)
Genome map
AA seq 698 aa AA seqDB search
MNPRRIFVTTALPYANGTFHIGHIMEYIQADIWVRTQRMLGHQVDFVGADDAHGAPIMIA
AEKAGKTPQQFVADIAAGRKQYLDGFLIRYDNWHSTDSAENVELSRAIYKDLKAAGLIEV
RAIEQFFDPQKGMFLPDRYIKGECPKCHVPDQYGDNCEVCGAVYAPTDLGHPYSALTGAK
PELRSSEHFFFRLSDARCVQYLQDWTQNGRLQPEVANKAREWFAEDENGKPKLGDWDVSR
DAPYFGIEIPDAPGKYFYVWLDAPVGYLASLKNLLEKRGESYDEYMKNPGLEQVHFIGKD
IITFHTLFWPAMLHFSGRKAPDNVFVHGFLTVNNGEKMSKSRGTGLDPLKYLNLGMNAEW
LRYYLAAKLSARNEDIDFNAEDFMLRVNADLIGKYINIASRAAGFITKRFDGRLGEVSAD
GDALLCHLQDAAPAITALLAGREYGKAVREIMALADRVNEYVDQNKPWELAKQPGMQGRL
HDVCTTCIQAFRLLTILLAPVLPRLAESVGQWLHAPFDRFAAARQRLPAGHAIGEYRHLM
QRVEAGQLQALFAPAEPAQEPPAESAQAASAASADGGAPGGEPVAEVITIDDFAKIDLRI
ARIVDCEAVQGSKKLLRLTLDAGEGRTRNVFSGIASAYKPEDLKGKLTVMVANLAPRKMK
FGVSEGMVLAASHADEKAHPGIYVLEPWPGAQPGMRVR
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgcgccgcatattcgtcaccaccgccttgccgtatgccaatggcacgtttcac
atcggccacatcatggaatacatccaggccgatatctgggtgcgcacgcaacgcatgctg
ggccatcaggtggatttcgtgggcgcggacgacgcgcacggcgcgcccatcatgattgcc
gccgaaaaggccggaaaaaccccgcagcaattcgtggccgatattgcagcgggccgcaaa
cagtatctggacggctttctcatccgctacgacaactggcacagcaccgacagcgccgaa
aacgttgaattatcccgggccatttacaaggatctgaaagccgccggcttgattgaagtg
cgcgccatcgagcagtttttcgacccgcaaaaaggcatgtttctgcccgaccggtatatc
aagggcgaatgccccaaatgccacgtgcccgaccagtatggcgacaactgcgaagtctgc
ggcgccgtttatgcgcccaccgacctgggccatccctattcggcgctcaccggcgcaaag
cccgaattgcgcagcagcgagcatttcttcttccgcctctcggacgcgcgctgcgtgcaa
tacctgcaagactggacgcaaaacggccgtctccagcccgaagtggccaacaaggcgcgc
gaatggtttgccgaagacgaaaacggcaagcccaaactgggcgactgggacgtcagccgc
gacgcgccctatttcggcattgaaataccggatgcgcccggaaaatacttttacgtgtgg
ctggacgcgcccgtgggttatctggccagcctgaaaaacctgctggaaaagcgcggcgaa
agctacgacgaatacatgaaaaaccccggcctggagcaggtacatttcatcgggaaagac
atcattactttccatacccttttctggcccgccatgctgcatttttcagggcgcaaggcg
ccggataatgtattcgttcacggttttctcaccgtcaataacggcgagaaaatgagcaaa
agccgtggcaccgggctggatccgctcaaatacctgaacctgggcatgaatgccgaatgg
ctgcgctattacctggcagccaagctttcggcgcgcaatgaagatattgatttcaatgcc
gaagatttcatgctgcgcgtcaatgccgatttgattgggaaatacatcaacatcgccagc
cgcgccgccggcttcatcaccaaacgctttgacggccggctgggcgaagtctcggcagat
ggcgacgccctgctgtgccacctgcaagatgcggcccctgccatcaccgcgctgctggcc
gggcgcgaatacggcaaggccgtgcgcgaaatcatggccctggccgaccgcgtgaacgaa
tacgtcgatcagaacaagccctgggagctggccaagcagcccggcatgcaaggccgcctg
cacgacgtgtgcaccacctgcattcaggcgtttcgcctgctcaccatcttgctcgcgccc
gtgctgccgcgcctggccgaaagcgtgggccagtggctgcatgcgccctttgaccgcttt
gccgccgcccgccagcgtctgcccgccggccacgccatcggcgaatacaggcacctcatg
cagcgcgtggaagccgggcagctccaggcgcttttcgcgcccgccgaaccggcccaagag
ccgcctgccgagtccgcccaggcggccagcgcggccagcgcggacggcggcgcgccgggc
ggcgagccggtggccgaagtcatcaccattgacgatttcgccaaaatcgaccttcgcatt
gcccgcatcgtggattgcgaagccgtgcaaggcagcaaaaagctgttgcgcctgacgctg
gatgcgggcgaaggccgcacccgcaacgtcttcagcggcatcgccagcgcctacaagccc
gaagacctcaagggcaagctcaccgtcatggtggccaaccttgcgccgcgcaagatgaaa
ttcggcgtgagcgaaggcatggtgctggccgccagccacgccgacgaaaaagcccatccc
ggcatctacgtgctcgaaccctggcccggcgcgcagcccggcatgcgcgtgcgctga

DBGET integrated database retrieval system