KEGG   Ottowia sp. oral taxon 894: ADJ79_12745Help
Entry
ADJ79_12745       CDS       T04031                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
oto  Ottowia sp. oral taxon 894
Pathway
oto00260  Glycine, serine and threonine metabolism
oto01100  Metabolic pathways
oto01110  Biosynthesis of secondary metabolites
oto01120  Microbial metabolism in diverse environments
oto01130  Biosynthesis of antibiotics
oto01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ADJ79_12745
Enzymes [BR:oto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ADJ79_12745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: AKU68304
UniProt: A0A0K1NGU4
Position
complement(2894104..2895168)
Genome map
AA seq 354 aa AA seqDB search
MDNPPFFARKSVAFFGNDYLAGCHPAIMERLAATNLEQTAGYGLDPYSESAREKIRAAVR
DERADVHFLVGGTQTNAAVIASILRPWQGVIAAETGHVATHETGAIEAGGHKVLTLRSTD
GKLTARQVHEYARYYQTNPAQEHLVQPGMVYISHPSELGTVYAKAELQAISQACREHGLA
LFVDGARLGYALHAQVSDITLPDLAGLCDVFYIGGTKCGALFGEAVVICNDAFKPHFRAL
MKQRGALLAKGRLLGLQFDTLFTGGLYTRICHGALAHARRIRQAFEAKGVAFHGESNTNQ
QFPILERRQADYFVREFGFADWEELDGRHVVRYCTSWATTAQQVDELLRAIERL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggataatccgcccttttttgcaaggaaatccgtggcgttttttgggaatgactacctg
gccggatgccatccggccatcatggaacggctggcggccaccaatctggagcaaaccgca
ggctacgggctggacccgtatagcgaaagcgcgcgcgaaaaaatccgcgccgccgtgcgc
gacgagcgggccgatgtgcactttctggtgggcggcacacaaaccaacgccgccgtcatc
gccagcatcctgcggccctggcagggcgtgatcgccgccgaaaccgggcacgtggccacg
cacgaaaccggcgccattgaagcgggcggccacaaggtgctgaccctgcgcagcacagac
ggcaagctcaccgcgcggcaagtgcatgaatacgcgcgctactaccaaacaaacccggcg
caagagcacctggtgcagccgggcatggtctacatctcgcaccccagcgagctgggcacg
gtgtatgccaaggccgaattgcaggccatctcccaggcctgccgcgagcacgggctggcg
ctgttcgtggatggcgcgcggctgggctacgcgctgcacgcgcaggtcagcgacatcacg
ctgcctgacctggccgggctgtgcgacgtgttctacattggcggcaccaaatgcggggcg
ctgtttggcgaagccgtggtgatttgcaacgacgccttcaagccgcactttcgcgccctg
atgaagcagcgcggcgccctgctcgccaaagggcggctgctgggccttcagttcgacacg
ctgttcaccggcggcctttacacgcgcatttgccacggcgctctggcgcacgcgcggcgc
atccgccaggcattcgaggccaagggcgtggcctttcacggcgaatcgaacacgaaccag
caatttcccattcttgagcgccggcaggcggactatttcgtgcgcgaattcggctttgcc
gactgggaggagctggacggccgccacgtggtgcgctactgcaccagctgggccaccacg
gcgcagcaggtggatgagctgctgcgggccattgagcggctttga

DBGET integrated database retrieval system