KEGG   Oryzomicrobium terrae: OTERR_21750Help
Entry
OTERR_21750       CDS       T06190                                 

Gene name
thrS
Definition
(GenBank) threonyl-tRNA synthetase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
otr  Oryzomicrobium terrae
Pathway
otr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:otr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OTERR_21750 (thrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:otr01007]
    OTERR_21750 (thrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:otr03016]
    OTERR_21750 (thrS)
Enzymes [BR:otr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     OTERR_21750 (thrS)
Amino acid related enzymes [BR:otr01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   OTERR_21750 (thrS)
Transfer RNA biogenesis [BR:otr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    OTERR_21750 (thrS)
 Prokaryotic type
    OTERR_21750 (thrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b tRNA_SAD HGTP_anticodon TGS DUF4228
Motif
Other DBs
NCBI-ProteinID: QEL65651
UniProt: A0A5C1E9J5
Position
complement(2437855..2439786)
Genome map
AA seq 643 aa AA seqDB search
MSSAVVNVQLPDGSVRSFDKPVSVADVAASIGAGLARAALAGKVDGKLVDTSFVIDRDAA
LAIITDKDADGLEVIRHSTAHLLAYAVKELFPAVQVTIGPVIDNGFYYDFAYTRAFTPED
LDAIEKKMAELAKRDIPVSREVWSRDDAVKFFLSLGEKYKAELIGAIPADQEVSLYREGD
FVDLCRGPHVPSTGKLKVFKLMKVAGAYWRGDSKNEMLQRIYGTAWAKKDEQDAYLHMLE
EAEKRDHRRLGKHLDLFHMQDEAPGMVFWHPKGWAIWQEIEQYMRNVYRENGYQEIRCPQ
ILDRSLWEKSGHWEHYKNNMFTTESEKRDYAIKPMNCPGHVQVFNSDLRSYRDLPLRYGE
FGSCHRNEPSGALHGLMRVRGFVQDDGHIFCTEDQIEAEVTAFNALVKKVYADFGFHHVA
VKLALRPDGRVGSDEIWDKAEDALRAGLKASGLEWEELPGEGAFYGPKIEFHIKDAIGRS
WQCGTMQVDFSMPGRLGAEYVAADNSRKVPVMLHRAILGSLERFIGILVENYAGALPLWL
APVQAVVLNISEKQADYAEEVVKALRQAGIRGEADLRNEKITYKIREHSVNHRQPYQLIV
GDKEKAERMVAVRIRGGQDLGQLPLSVLVERLQKEIAARKGTA
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgccgtggtgaatgtgcaattgcccgatggctccgtacggagcttcgataaa
cccgtaagcgtggccgatgttgcggcttccattggtgctggtctggctcgtgccgcgttg
gccggcaaggtcgatgggaaactggtggatacttcctttgtcattgatcgtgatgctgct
ttggcgatcatcaccgacaaggatgcggatggtctggaagttattcgccattcaaccgct
cacctgctggcttacgcggtcaaggaactgttccccgcggtgcaagtgaccatcgggccg
gtcatcgacaacggcttctactacgacttcgcctatacccgggcatttacgcccgaggat
ctggatgccattgagaagaagatggccgagctggccaagcgcgatattccggtctctcgg
gaggtctggtcgcgggatgacgcagtgaagttcttcctgtccctgggagagaagtacaaa
gcggagctgattggggcgattcccgccgatcaggaggtttccctataccgagagggcgat
ttcgtcgacctgtgtcgcggcccccacgtgccctccactggcaagctcaaggtcttcaag
ctgatgaaggtcgctggcgcctactggcgtggcgactccaagaacgagatgctgcagcgc
atctacggtacggcctgggctaagaaagatgagcaggatgcctacctgcacatgctggaa
gaggccgaaaagcgggatcaccgccgcctgggtaagcacttggatctgttccacatgcag
gacgaggcgccgggcatggtgttctggcaccccaagggctgggccatctggcaggaaatc
gagcagtacatgcgcaatgtgtatcgggaaaacggctaccaggagattcgttgcccgcag
attcttgatcgttccctgtgggagaagtccggccactgggagcactacaagaacaacatg
ttcaccaccgaatcggaaaagcgcgactacgcgatcaaaccgatgaactgcccggggcac
gtacaggtgttcaattccgacctgcgctcctaccgggatctgcctctgcgctacggtgag
ttcggttcctgccatcgcaacgagccctcgggtgcgctgcacggtctgatgcgggtgcgc
ggcttcgtccaagatgatggtcatatcttctgcaccgaagatcagatcgaggctgaggtg
acggcctttaatgcgctggttaaaaaggtatatgccgacttcggcttccaccacgtggcg
gtcaaattagcgctacgcccggatgggcgtgtcggttccgacgagatttgggacaaggct
gaggatgctctgcgcgccgggctcaaggcctccggcctggagtgggaggagttgccgggc
gagggggcgttctatggcccgaagatcgaattccacatcaaggatgccatcggccgctcc
tggcagtgcggcaccatgcaggttgacttttccatgcctggtcgcctgggggctgagtac
gtagcggctgacaacagccgtaaggttccggttatgcttcatcgcgccatcctgggttcc
ctggagcgcttcatcggtattctggtggaaaactatgccggggcgctgccgttatggctg
gcgccggttcaggcggtagtgttgaatatttccgaaaaacaagccgattacgctgaagaa
gtggtgaaagccctgcgccaggcgggcatccggggtgaggcggatttgcggaatgagaaa
attacctataaaattcgcgagcatagcgtaaatcaccgccagccctatcagctcatcgtg
ggtgataaggaaaaggcggagcgcatggtggccgtgcgaattcgcggtggccaggatctc
gggcagttgcccttgagtgttctggtggagcgtctccagaaggagattgcggcgcgaaaa
ggcacggcttag

DBGET integrated database retrieval system