KEGG   Orientia tsutsugamushi Boryong: OTBS_1489Help
Entry
OTBS_1489         CDS       T00531                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ots  Orientia tsutsugamushi Boryong
Brite
Enzymes [BR:ots01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     OTBS_1489 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N RhoGEF Endopep_inhib
Motif
Other DBs
NCBI-ProteinID: CAM80570
UniProt: A5CEI5
Position
1449292..1449933
Genome map
AA seq 213 aa AA seqDB search
MTFSKTANQTSYPFKLMELPYSKNSMEQYISSEAFDYHHGKHHAAYVNNLNRLLEHKAEL
QQKSLEDIILTSFNSEGSKAIFNNAAQIWNHNFFWHSICNNNATKPEGNFLQKINQDFGS
YENFTNQFQELALAQFGSGWVWLISENCKLKIITTSNAELPIIYNQIPLLTCDVWEHSYY
IDYRNNRAKYLQQFIEHLANWQFAEQNFLNSIK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgactttttctaaaactgctaatcaaacaagttatccgtttaaattaatggagttgcca
tattctaaaaattcaatggagcaatatatatcaagtgaagcatttgattaccatcatggt
aagcaccatgctgcttatgttaataacttaaatcgattgcttgaacataaagctgaatta
cagcaaaaatcgttagaagatattatcttaacttcatttaattccgaaggaagcaaagct
atatttaataatgcagcacaaatttggaatcataattttttttggcattcgatatgcaat
aataatgcaactaaacctgaaggaaattttttacaaaaaatcaatcaggattttggtagc
tatgaaaattttactaatcaatttcaagagctagcacttgcgcaatttggtagtggttgg
gtctggttgatatctgaaaattgtaagctaaaaattataaccacatctaatgctgaattg
ccaataatttataatcaaataccgttattaacttgtgatgtatgggaacattcttattat
attgattatcgtaataatagggcaaaatatttacaacagtttatagagcatttagcaaat
tggcaatttgctgaacaaaattttttgaattctattaagtga

DBGET integrated database retrieval system