KEGG   Orientia tsutsugamushi Ikeda: OTT_0491
Entry
OTT_0491          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TraN
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
ott  Orientia tsutsugamushi Ikeda
Brite
KEGG Orthology (KO) [BR:ott00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ott02044]
    OTT_0491
Secretion system [BR:ott02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   OTT_0491
SSDB
Motif
Pfam: TraN
Other DBs
NCBI-ProteinID: BAG39949
UniProt: B3CQV9
Position
508304..509503
AA seq 399 aa
MEFAKKEIVKNHSNWLKSRSDVYDKSGAQIYCLVDDPEAIERQMKMAIANRLGVPTQHIG
RNFLLHEKNEICILEYDYRDKTQELREVAEYWKVLNPELEQLTESNECYEVNRINYDGGD
RVFFDKFRVNRPYWKQKIVFSCTSDPKDGCKHLKIQNCELKNSTCQKSVANICLLWQHDY
SCSTEKQTMLHSSLRNNSIFCLGGNCNTPTIIPNRDIAKVAHLAMLNQMSKDIKTNPVSV
FSGKHRKCKKDVFSFLNCCSSMTGWGRDIGLSQCKSKEQELALYRKKGYCYYIGTYCSSR
IPILGICLARKSTYCCFQSKLARIFQEEARKQLKIDFGTPECPKCRGLTVKELQKVDFTK
INMDELFGDILTKAQNSMNKDIIAGIKDKVHRMQQSQSK
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaatttgcaaaaaaagaaatagtgaagaatcatagcaattggcttaagagtcgtagc
gatgtctatgataaatcaggggcgcaaatatactgcctagtagatgatcccgaagcaatt
gaaagacaaatgaaaatggctattgctaataggctcggtgtacctacacagcatattggt
agaaattttttattacatgaaaaaaatgaaatatgtatacttgaatatgactacagagat
aagactcaagaactaagggaagtagcagaatattggaaagttttaaaccctgaacttgag
caattaacagaaagtaacgaatgctatgaggtcaatcgaatcaactatgatggtggtgat
agagtattttttgacaagtttagagttaatcgtccatattggaaacaaaagattgttttt
tcttgtactagcgatccaaaagatggttgcaaacaccttaaaattcaaaattgcgaatta
aaaaatagcacttgccaaaaatcggtagcaaatatttgtttactatggcagcacgattat
agctgttcaactgagaagcaaacaatgctacactcatcattgcgtaataactcaatcttt
tgtttaggaggtaattgcaacactccaactattataccaaacagggatatagctaaagta
gctcatctagcgatgctaaatcagatgagcaaagacattaaaacaaatcccgtttctgta
ttttcaggtaaacatcgcaaatgcaaaaaagatgtatttagttttttgaattgctgctct
tcaatgactggctgggggcgtgatataggcttatcacaatgcaaatctaaagaacaagaa
ttagctctatatagaaaaaaaggttactgctactatattggaacctactgttcttcaaga
attccgatattaggtatttgcttagccagaaagtctacttattgctgctttcagtcgaaa
ctggcaagaatttttcaggaagaagcaagaaaacagctaaaaatagactttggaacacct
gaatgtccaaagtgtagaggccttactgttaaggaattacaaaaagttgatttcactaaa
atcaatatggatgaactatttggtgatatactcactaaggctcaaaacagcatgaacaaa
gacattattgcaggaatcaaagataaagttcatcgtatgcaacaaagtcagtctaaatga

DBGET integrated database retrieval system