KEGG   Orientia tsutsugamushi Ikeda: OTT_0492
Entry
OTT_0492          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TraF
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
ott  Orientia tsutsugamushi Ikeda
Brite
KEGG Orthology (KO) [BR:ott00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ott02044]
    OTT_0492
Secretion system [BR:ott02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   OTT_0492
SSDB
Motif
Pfam: TraF Doppel TFIID-31kDa
Other DBs
NCBI-ProteinID: BAG39950
UniProt: B3CQV8
Position
509500..510126
AA seq 208 aa
MSRLLMFMILISHLSTVDASPTGFLWYNDKHDHELNKSASNSELILAVHDHRIEELKEQF
NRAQRIALDNPTLENVITAQRLQKQIMEKAHKFATMWQLATLLDYQLINANEPSNSLHRK
LYQEKSEQKNDLKLKNIAKNWGLILQVKQDCLLCKAFMPIVQGFANKYAFQLLAVSKNNE
LLNKLNPKHVVPVLYLVASDGKKNICSS
NT seq 627 nt   +upstreamnt  +downstreamnt
atgagcagattactaatgtttatgatattaattagtcatttatccactgttgatgcttca
ccaacaggatttctatggtataatgataaacatgatcatgagctgaataaatctgcttct
aattctgagctgatattggctgtccatgaccatagaatcgaggaattaaaggagcaattt
aatcgagctcagcgtatagcgcttgataatccaacgctcgaaaatgtgattacagctcaa
aggctacagaaacaaatcatggagaaggcacataagtttgctactatgtggcaactagct
actttacttgattatcaactgattaatgctaatgagccatctaatagcttacatagaaag
ctgtatcaagaaaaatcagagcagaaaaacgacttaaaactcaaaaacattgctaaaaac
tggggcttgattctgcaagttaaacaagattgcttgctatgtaaggcctttatgcctatt
gttcagggctttgctaataaatatgcatttcagttgctagctgtcagtaagaataatgag
ttgctaaataaactaaaccctaagcatgttgtgcctgtattatatctagtagctagcgat
ggtaaaaaaaatatatgcagtagctag

DBGET integrated database retrieval system