KEGG   Orientia tsutsugamushi Ikeda: OTT_1498
Entry
OTT_1498          CDS       T00705                                 
Name
(GenBank) hypothetical protein
Organism
ott  Orientia tsutsugamushi Ikeda
SSDB
Motif
Pfam: ZipA_C
Other DBs
NCBI-ProteinID: BAG40956
UniProt: B3CQH6
Position
complement(1527850..1528179)
AA seq 109 aa
MKFLLLLLGCMSLTSFFYRSTFDCKIPKGLKCKSLYEIKNMVAQGAFDIDNLEKVETSKT
KSKRRCILCYRQAKAIQSVAVVNKSPKKPKKYLINLFKSKQSQGERKHT
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaagtttttattattgctattgggctgtatgagcttaaccagcttcttttacagaagt
acttttgattgtaaaattcctaaagggctaaaatgtaagtctttatatgaaataaagaat
atggttgctcaaggcgcttttgatattgataatcttgagaaagttgaaacatccaaaact
aaatcaaaaagacgttgtattctatgctacaggcaagctaaagctattcaaagcgtagct
gttgttaataagtcgccgaaaaaaccaaaaaaatatcttattaatttatttaaatcaaaa
cagagtcaaggtgaacgcaagcatacataa

DBGET integrated database retrieval system