KEGG   Orientia tsutsugamushi Ikeda: OTT_1567Help
Entry
OTT_1567          CDS       T00705                                 

Gene name
virD4
Definition
(GenBank) type IV secretion system protein VirD4
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
ott  Orientia tsutsugamushi Ikeda
Pathway
ott03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ott00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    OTT_1567 (virD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ott02044]
    OTT_1567 (virD4)
Enzymes [BR:ott01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     OTT_1567 (virD4)
Secretion system [BR:ott02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   OTT_1567 (virD4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: BAG41025
UniProt: B3CUH8
Position
complement(1594095..1595867)
Genome map
AA seq 590 aa AA seqDB search
MNENAFLTKIRNLVIKIMVHCIGVILVVFIIKFFILLFTVKHQNLIDVLLTFNVSIVYQY
LIWIINSWSLIDFSSYDYLKLKLVFSFIVPPVITIVLYIKNFEKIKSWQPYKLKEKVYGD
ARWGDQDDIKRAGLRSKHGTLLGVDKGGYYVADGFQHALLFAPTGSGKGVGFVIPNLLFW
EHSVIVHDIKLENYELTSGWRAQQGQNVYVWEPANPDGITHCYNPIDWVSSKPGQMVDDV
QKIANLIMPEKDFWNNEARSLFLGVVLYLIADNTKAKTFGEVVRTMRSNDVVYNLAVVLD
TMGAVIHPVAYMNIAAFLQKADKERSGVISTMNSGLELWANPLIDAATASSDFNILEIKR
KKTTIYVGLTPDNINRLQKLMQVFYQQSTEFLSRKIPDVKEEPYGVMFLLDEFPTLGKME
QFKTGIAYFRGYRVRLFLIIQDTQQLKGTYEEAGMNSFLSNSTYRITFAANNYETANLIS
QLCGNKTVKQASHSQPRFFDLNPATRTMNISEVQRALLLPQEVILLPRDEQIILIESFPP
IRSKKVKYYEDKFFTSRLLPPSFVPTQTPYVPPDYNATADDSNNVDNNQK
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagaatgcatttttaactaagattagaaatctagttataaagataatggttcat
tgtattggagtaatattagtagttttcattattaaattttttatactcttatttactgtt
aaacatcaaaatttaatagatgtattactaacttttaatgtatccattgtatatcaatat
ctaatctggattataaattcttggagtttaattgattttagtagttatgattacttaaaa
cttaaattagtattttcatttatagttccacctgttataactatagtgttatatatcaaa
aatttcgagaaaattaagagttggcaaccatataaattgaaagaaaaagtatacggtgat
gcacgttggggagatcaagacgatataaaaagagctggtcttagatcaaaacatggtaca
ttgttaggtgtagataagggaggatactatgttgcagatggatttcaacatgctttatta
tttgctcctactggttcaggtaaaggggtaggttttgtaattccaaacttattattttgg
gaacattcagtaatagttcacgatattaagcttgaaaattatgaattaactagtggctgg
cgagctcagcaaggacaaaatgtttatgtatgggagccagctaatccagatggtattact
cattgttataatccaatagattgggttagtagtaaacctgggcagatggttgatgatgtg
cagaaaattgctaacctaattatgccagaaaaagacttttggaataatgaggctagaagt
ctgtttttaggagttgtattatacttaattgctgataatacaaaagctaaaacatttggt
gaagtggttcgtactatgcgcagtaatgatgtagtatataatttagcagtagtattagat
actatgggagcagttattcatccagttgcttatatgaatattgctgcttttcttcaaaaa
gctgataaagaacgctctggagtaatatcaactatgaattctggtcttgaattatgggcc
aatccattaatcgatgctgcaactgcttcatcagatttcaatatcttagaaataaaaaga
aaaaaaacaacaatatacgttggcttaacacctgataatatcaatagattgcaaaaatta
atgcaagtattttatcaacagtctactgaatttttgagcagaaaaattcctgatgttaag
gaagaaccttatggagtaatgtttctattggatgagtttccaactttaggtaaaatggaa
caatttaaaactggaattgcttattttcgaggttatagagtaaggctatttttgattatt
caagatacgcagcagttaaaaggaacatatgaagaagcaggaatgaattcatttttatct
aattctacttatagaattacatttgctgctaacaattatgagactgctaacttgatatca
cagttatgtggcaataaaacagttaaacaagcttcacatagtcaacctcgcttttttgac
cttaatccagctactagaactatgaatatttctgaagtacaaagagcattattattacca
caagaggttattttattgccacgcgatgagcaaattattttaattgaatcgtttccacca
atacgatctaaaaaggttaaatattatgaggataagttttttactagtagattactgcca
ccttcatttgttccaactcaaacaccttatgttcctccagattataatgctacagctgat
gatagtaataacgtagacaataatcaaaaataa

DBGET integrated database retrieval system