KEGG   Orientia tsutsugamushi Ikeda: OTT_1705
Entry
OTT_1705          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TraB
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
ott  Orientia tsutsugamushi Ikeda
Brite
KEGG Orthology (KO) [BR:ott00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ott02044]
    OTT_1705
Secretion system [BR:ott02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   OTT_1705
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: BAG41163
UniProt: B3CS83
Position
1729740..1730558
AA seq 272 aa
MRAKWTEEILNEVKTLKDRLESVIESRYLETTAQINNFNQKLEILENQPKQSLYNNDSDE
FSSDLNHHILNSPHDNKTEQAPVVVVKPYVNLRRAGSEPKKNVENYVTSGSSARAVLLIE
VVVGTGTNSSSSPEPIVLQLLDTAILYDKYKTDQIKKAILIGSCNGEMSSERAKCRIETL
SVVNNQGDIIEKKVEGWLIGEDGRSGIKGIVVDKSSNIAGMAALNGVFSSIAKFLQSKAI
KPDMLPTLNLVAGGQQQEFQIGEVSVWSLRWS
NT seq 819 nt   +upstreamnt  +downstreamnt
ttgagagcaaaatggacagaggaaatacttaatgaagtcaaaacattaaaagatagatta
gaaagtgtaatagaaagcagatatttagagactacagcccaaattaataattttaaccaa
aaacttgagatattggagaatcagcctaaacagagtctatataataatgatagtgatgaa
tttagttctgatcttaatcatcatattttaaattcaccacatgataacaaaacagagcaa
gctcctgtagtagtagtaaagccttatgtaaatcttaggagagctggatctgagccaaaa
aaaaatgttgagaactatgttactagcggtagttctgctagagctgtgctacttattgaa
gtcgttgtaggtactggaactaatagctcttcatcaccagaaccaattgttctgcagttg
cttgatacagcaattctttatgataaatataaaactgatcaaatcaaaaaggcaatttta
attggatcctgtaacggagagatgtcctcagagagagctaaatgtcgcatcgaaactctt
tcagtagtcaataaccaaggagatattatcgagaaaaaggtggaaggctggttgataggc
gaagacggacgttctggaattaaaggaatcgtggtggataaatcgtctaacatagcaggc
atggctgcattaaatggagtatttagcagtatagctaagtttctgcaatctaaggctatt
aaacctgatatgctaccaactttaaacctagtagctggaggccaacaacaagagtttcag
attggagaggtttcagtctggagcttacgctggagctag

DBGET integrated database retrieval system