KEGG   Orientia tsutsugamushi Ikeda: OTT_1816
Entry
OTT_1816          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TraE
Organism
ott  Orientia tsutsugamushi Ikeda
SSDB
Motif
Pfam: TraE
Other DBs
NCBI-ProteinID: BAG41274
UniProt: B3CV77
Position
1847799..1848350
AA seq 183 aa
MNHLFKQNAIQELVKYNKCLLSVTILLAAANIIAIMAAITKEEKWLLIPAMEPDGKMTIS
SKNYHETYLKEWAIYVTKLLFTTSPNEVERQIANMKVASSNTESLNKFFHDHLQFVKGSN
VSSVFFPKNVEVIKDGVLISGTLRYWFSDSKDIAVDKTYLLTYKQTPNYLLLLTGVKENG
IKK
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaatcatctctttaagcaaaatgctatacaagagctggttaaatataataaatgctta
ctttcagtaactatattgctagctgcagctaatataattgcgataatggctgcaattacc
aaagaagaaaagtggttattaattccagcaatggagcctgatggtaaaatgacgatttca
tcaaaaaattaccatgaaacctatttaaaggaatgggcaatttatgtaacgaaactctta
tttactacttctccaaatgaggtagaaagacaaatagcaaacatgaaagtggcatctagt
aatactgaatctttaaataaattttttcatgatcacttgcaatttgttaaaggctcaaat
gtatcttcagtcttttttccaaagaatgttgaagtgataaaggatggagtattaattagt
ggaacgcttcgttattggtttagcgatagtaaagatatagctgtcgataagacttacctt
ttgacttacaagcaaactcctaattaccttttattgttgactggtgttaaagagaatgga
ataaaaaaatga

DBGET integrated database retrieval system