KEGG   Orientia tsutsugamushi Ikeda: OTT_1905
Entry
OTT_1905          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TraE
Organism
ott  Orientia tsutsugamushi Ikeda
SSDB
Motif
Pfam: TraE
Other DBs
NCBI-ProteinID: BAG41363
UniProt: B3CV77
Position
1942394..1942945
AA seq 183 aa
MNHLFKQNAIQELVKYNKCLLSVTILLAAANIIAIMAAITKEEKWLLIPAMEPDGKMTIS
SKNYHETYLKEWAIYVTKLLFTTSPNEVERQIANMKVASSNTESLNKFFHDHLQFVKGSN
VSSVFFPKNVEVIKDGVLISGTLRYWFSDSKDIAVDKTYLLTYKQTPNYLLLLTGVKENG
IKK
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaatcatctctttaagcaaaatgctatacaagagctggttaaatataataaatgctta
ctttcagtaactatattgctagctgcagctaatataattgcgataatggctgcaattacc
aaagaagaaaagtggttattaattccagcaatggagcctgatggtaaaatgacgatttca
tcaaaaaattaccatgaaacctatttaaaggaatgggcaatttatgtaacgaaactctta
tttactacttctccaaatgaggtagaaagacaaatagcaaacatgaaagtggcatctagt
aatactgaatctttaaataaattttttcatgatcacttgcaatttgttaaaggctcaaat
gtatcttcagtcttttttccaaagaatgttgaagtgataaaggatggagtattaattagt
ggaacgcttcgttattggtttagcgatagtaaagatatagctgtcgataagacttacctt
ttgacttacaagcaaactcctaattaccttttattgttgactggtgttaaagagaatgga
ataaaaaaatga

DBGET integrated database retrieval system