KEGG   Orientia tsutsugamushi Ikeda: OTT_1911
Entry
OTT_1911          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TraC
  KO
K12063  conjugal transfer ATP-binding protein TraC
Organism
ott  Orientia tsutsugamushi Ikeda
Brite
KEGG Orthology (KO) [BR:ott00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ott02044]
    OTT_1911
Secretion system [BR:ott02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   OTT_1911
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG DUF5934 FtsK_SpoIIIE AAA_10 MeaB AAA_24 NACHT AAA_18 Viral_helicase1
Other DBs
NCBI-ProteinID: BAG41369
UniProt: B3CVH2
Position
1945791..1947593
AA seq 600 aa
MNASIHKDFDRERFSKHFVYESYDDETQLFFNRCSIGFVLLACPLAEASVSAQNEIAEFL
KSDENLPAESSLQVLMIGSNNIENFLSNWQSYRKGEIFIELANKRTEFLRDQAQKVGSIK
DVVLLISVTIPNLNANIDDMIRRRDALKDTFRSIGLSTENVNAQQLLKFLRVIFGWPEEE
HSNINQYEILSEQILSGDFSLFENDDCVNVNDDQIFISLEARKRPAEWKLSAMDLFLGNE
MRRDEYIKSNFLIHFGLQILPNQAMERTAAITKREALERNINAGMGKFFPDIQQEAADLA
GVVAALQSGDRVVNIHFNVIMFDKIKKAKQSASAFCSMLRRSGWYFVPCKYDHVAVLLAA
LPMQLVEQGPKGILGQKTSGVGVALSSLGRGIKTVSVESKVLLPIISEWKGDLSSPGMLL
AGRRGQIMYWSPFGGALLPALNKHGVAPNENFNLCIAGVPGSGKSVFMQELMLSVLGVGG
KVFVLDYGRSFKRTCLILGGSYIEFDMKNPVSINPFSEVPEDDSAKSIEARSDFLSNFPS
ILATMAAPQYGTSDLQQPMLQRALISVLFFLIYSMCSSNFSFNFSTSFTSFCYISALNFC
NT seq 1803 nt   +upstreamnt  +downstreamnt
gtgaacgcaagcatacataaggattttgatcgagaaagattttctaaacactttgtctat
gaatcatatgatgatgagactcagctattctttaatcgttgttcaataggctttgtattg
cttgcatgcccattggctgaagctagtgtttcggctcaaaatgaaattgctgaatttctg
aaaagcgatgaaaatttacctgctgaaagtagccttcaagtattgatgattggtagtaat
aatatagagaattttttaagcaactggcagtcatatcgtaaaggagagatatttattgag
ttagcaaataaaagaacagagtttttgcgtgatcaagctcaaaaagtaggttctataaag
gatgtagtattgttaatttcagttactatacctaatttaaatgcaaatatcgatgatatg
attcgcagacgagatgctttaaaagatacgtttaggtcaattggattaagcactgaaaat
gtgaatgcgcagcaattattaaagtttctgagagtaatatttggctggcctgaagaagaa
cattcaaatattaaccagtatgaaatattgtctgaacaaattctaagtggagatttttcg
ttatttgagaatgatgattgtgtaaatgtaaatgatgatcaaatatttatcagtctagaa
gcaagaaagaggcctgcagagtggaaattatctgctatggatctgtttttaggtaatgaa
atgcgtcgtgatgaatatataaaatcaaatttcctgattcattttggtctgcaaatttta
ccaaatcaagcgatggaaaggactgctgccataactaaaagagaagcgctagaaagaaat
attaatgcgggaatgggtaaattttttcctgacatacaacaagaagctgctgatttagct
ggtgtagtagctgctttacagagtggtgatagagtcgttaatattcacttcaatgttatt
atgtttgacaaaataaaaaaagctaagcaatctgcatcggccttttgttcgatgttaagg
cgcagtggatggtattttgtgccatgtaaatatgatcatgtggccgtgttactagctgca
ctaccaatgcaattagttgaacaaggcccaaaaggtatattgggtcaaaaaacatcagga
gttggagtagcactttctagcttaggtagaggcataaaaactgtttctgtagagagtaaa
gtattattgccaatcattagtgaatggaaaggtgatttaagctctccaggtatgttgcta
gctggaagacgaggtcaaataatgtactggtcgccttttggtggagctttattacctgcg
ttaaataagcatggagtagctccaaatgagaactttaacctttgtatagctggagttcca
ggctctggaaaatctgtttttatgcaagaattaatgctatctgttctaggagttggtggt
aaagtttttgttcttgattatggaagatcatttaagcgtacatgcttgattctaggcggc
agctacatagaatttgacatgaaaaatcctgtatcaattaatccattttcagaggtgcca
gaggatgatagtgcaaagtctatagaggctagatcagactttttatctaactttccatct
attttagctactatggcagctccacagtatggaacaagcgatctacaacaaccaatgcta
cagagagctttaatatctgtgctattcttcctcatatatagcatgtgctcctccaacttc
agcttcaacttcagcaccagcttcaccagcttctgctacatcagtgcgttgaatttttgt
taa

DBGET integrated database retrieval system