KEGG   Orientia tsutsugamushi Ikeda: OTT_1914
Entry
OTT_1914          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TrbC
  KO
K12059  conjugal transfer pilus assembly protein TrbC
Organism
ott  Orientia tsutsugamushi Ikeda
Brite
KEGG Orthology (KO) [BR:ott00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ott02044]
    OTT_1914
Secretion system [BR:ott02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   OTT_1914
SSDB
Motif
Pfam: TrbC_Ftype Thioredoxin_3 SYCP2_SLD T6SS_VasE
Other DBs
NCBI-ProteinID: BAG41372
UniProt: B3CUX4
Position
1949267..1949650
AA seq 127 aa
MVIRVMMLMVLLFVNNANAFFLDKQKTFIFVSFSMSDEALKSYFAESQKAGAQLVMRGLI
NNSFTQTKNKTMELDISFDIDPSLFEQYKIDVVPVIVIDDKKRGLTKKLTGHIPLASALE
IMNENTP
NT seq 384 nt   +upstreamnt  +downstreamnt
atggttatacgagtaatgatgttgatggttttattatttgttaataatgctaatgctttt
tttttggacaagcaaaaaacttttatttttgtctcattttcaatgagtgatgaggcttta
aaaagctattttgctgagtctcaaaaggctggagctcaattagttatgcgtgggttaatt
aataactcatttacacaaacaaagaataaaactatggagcttgatattagcttcgatata
gatcctagcttgtttgaacaatataaaattgatgttgtaccagtgatagtaatagatgat
aaaaaaagaggattaaccaagaaattaactggccatattcctttagcaagtgcattagaa
attatgaatgagaatactccatga

DBGET integrated database retrieval system