KEGG   Orientia tsutsugamushi Ikeda: OTT_1915
Entry
OTT_1915          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TraN
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
ott  Orientia tsutsugamushi Ikeda
Brite
KEGG Orthology (KO) [BR:ott00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ott02044]
    OTT_1915
Secretion system [BR:ott02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   OTT_1915
SSDB
Motif
Pfam: TraN
Other DBs
NCBI-ProteinID: BAG41373
UniProt: B3CVH6
Position
1949647..1951341
AA seq 564 aa
MRLLSILTLITLNISSCIASMQSSYNEAKNYNVNLGNSSNTQELFHQGSNVNYPNNDEDL
TYHGRNQLGTESGAMLFQAENSKNNALTQHNINDQNYMIANSMRIESDPLSALDSSNFVT
QTSTTNTEIIQSCTEGSNFNIELIRELNVECRLDNVWLSWQNRQMEFATKEIKENHSNWL
KSRSDVYDDESGAQIYCLVDDPEAIERQMKWAIVNRLGVSTQHIGRNFLLHEKNEICILH
YDYRDKTQELREVAEYWQVLTPELEQLTESNECYEVNRINYESGDRVFFDKFKVNRPYWK
QKIVFSCTSDPKDGCKHLKIQNCELKNSTCQKSVANICLLWQHDYSCSTEKQTMLHSSLR
NNSIFCLGGNCNTPTIIPNRDIAKVAHLAMLNQMSKDIKTNPVSVFSGKHRKCKKDVFSF
LNCCSSMTGWGRDIGLSQCKSKEQELALYRKKGYCYYIGTYCSSRIPILGICLARKSTYC
CFQSKLARIFQEEARKQLKMNFGTPECPKCRGLTVEELQKVDFTKINMDELFGDILTKAQ
NSMNKDIIAGIKDKVHRMQQNRSY
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgagattattatctatattaactttaataacgctcaatattagcagttgtatagcttca
atgcaaagcagttataatgaagctaaaaactataatgtaaatcttggaaattcttcaaat
acacaagaattatttcatcaaggtagtaatgtcaattatcctaacaatgatgaggattta
acctaccatggccgtaatcagcttggtacagaaagtggtgcaatgttatttcaagctgaa
aacagtaaaaacaacgccttaactcaacataatatcaatgatcaaaattatatgatagct
aattcaatgagaattgaatctgatcctttaagcgcacttgatagcagtaacttcgtaact
cagacaagtacaactaatactgaaattattcaaagttgtactgaaggcagtaattttaac
attgaacttattcgagaattgaatgttgagtgcagattagataatgtatggctttcttgg
caaaaccggcaaatggaatttgcaacaaaagaaataaaggagaatcatagtaattggctt
aagagtcgtagcgatgtctatgatgatgaatcaggtgcacaaatatactgcctagtagat
gatcccgaagcaattgaaagacaaatgaaatgggctattgttaataggctcggtgtatct
acacagcatattggtagaaattttttattacatgaaaaaaatgaaatatgtatacttcac
tatgactacagagataagactcaagaactaagggaagtagcagaatattggcaagtttta
acccctgaacttgagcaattaacagaaagtaacgaatgctatgaggtcaatagaatcaac
tatgagagtggtgatagagtattttttgacaagtttaaagtcaatcgtccatattggaaa
caaaagattgttttttcatgtactagcgatccaaaagatggctgcaaacaccttaaaatt
caaaattgtgagttaaaaaacagcacttgccaaaaatcagtagcaaatatttgtttacta
tggcagcacgattatagctgttcaactgagaagcaaacaatgctacactcatcgttgcgt
aacaactcgatcttttgtttaggaggtaattgcaacactccaactattataccaaacagg
gatatagctaaagtagctcatctagcaatgctaaatcagatgagcaaagatattaaaaca
aatcctgtttctgtattttcaggtaaacatcgaaaatgcaaaaaagacgtatttagtttt
ttgaattgctgctcttcaatgactggctgggggcgtgatataggcttatcgcaatgcaaa
tctaaggaacaagaattagctctatatagaaaaaaaggttattgctactatatcggtacc
tactgttcttcaagaattccgatattgggtatttgcttagctagaaagtctacttattgc
tgctttcagtcgaaacttgctagaatttttcaggaagaagcaagaaaacagctaaaaatg
aactttggaacacctgaatgtccaaagtgtagaggactaactgttgaagaattacaaaaa
gttgatttcactaaaatcaatatggatgaactatttggcgatatactcactaaggctcaa
aacagcatgaacaaagacattattgcaggcatcaaagataaagttcatcgtatgcaacaa
aacagatcttattga

DBGET integrated database retrieval system