KEGG   Orientia tsutsugamushi Ikeda: OTT_1919
Entry
OTT_1919          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TraH
Organism
ott  Orientia tsutsugamushi Ikeda
SSDB
Motif
Pfam: TraH
Other DBs
NCBI-ProteinID: BAG41377
UniProt: B3CS72
Position
1953827..1954492
AA seq 221 aa
MSCSGIDAYLGSFSVISGEELVQLMKNIGSQAKVYAFSLGLKTFAPQIENALKDLRNLAM
EMNQFAKGDCELTKALFATALPRNSVMREAVCRDIQSQSGFDYFAAGKKCRNYLDQKQAL
RQAQNKDSELMLDDYNIFTKAAAKVGIPSNMRDSIMSMTGTIVVTNNNVHFYDSLAQDEK
SWISHLKGGESASIYSCDNVSCLHSTLATKYHNITRAVLCR
NT seq 666 nt   +upstreamnt  +downstreamnt
atgagctgtagcggtattgacgcctatcttggtagcttctctgttatttctggagaagaa
ttagttcaactaatgaagaatattggttctcaagctaaagtttatgcattttcattagga
ttaaaaacctttgctcctcaaattgagaatgctctcaaagacttacgtaatctagcaatg
gagatgaatcaatttgctaagggagattgcgaattaacaaaagcattatttgctacagct
ttaccaagaaactcagttatgagagaagctgtttgccgtgatatacagtcacaaagcggg
tttgattattttgcagctggtaaaaaatgtcgtaattatttagatcaaaaacaagctctg
agacaagcgcaaaataaggattcagagttaatgcttgatgattataacatcttcactaaa
gcagcagcgaaggttggaataccatcaaatatgcgtgattcaatcatgtctatgactggc
actatcgtggttacaaacaataatgtacacttttatgactccttagctcaggacgaaaaa
agttggattagtcatttaaaaggcggagaatcagcctcgatttacagttgtgataatgtc
agttgcttgcattcaacgcttgcgacgaaatatcacaatatcaccagagcagtcttatgc
aggtaa

DBGET integrated database retrieval system