KEGG   Orientia tsutsugamushi Ikeda: OTT_1927
Entry
OTT_1927          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TraA
Organism
ott  Orientia tsutsugamushi Ikeda
SSDB
Motif
Pfam: AAA_30 MobA_MobL AAA_19 Viral_helicase1 AAA_11 PIF1 PhoH AAA_22 ResIII FlbD RIX1
Other DBs
NCBI-ProteinID: BAG41385
UniProt: B3CVI8
Position
complement(1960596..1962608)
AA seq 670 aa
MRIGIEMAIQFTRIEFLTRSKGGDSCRKAAYNARTIVENEKTGIKYNFSRKKDNVYHTVL
IPDYINQEFKNIQTLMNEVERTAKNQKNSQLLKDIVIALPDEKELNLEHRIEITHQIVDA
MEWVQNGLGVQIDIHKPHTGDKNWHAHILLTIRRFREDGTGLGDIAVDLNPKIITLSNGK
KVVIKDPEMIHEIVKDIINAYFAKLGLPYRVDEISEVPGEHMGRIKIRSLINKVVNENEL
RKEAHLKIINDADVITDSITHYKSIFTKQDIEKAVKDIPDLTAREQLVQQVLSSNRILEL
YHDDGESSKYFTTIEVRNEETRIIRIANKINDQVYYNDIYNLKSDIEGLANVSEEQKQAL
RHILLSTSGVRVLRGRAGTGKSYVLIKAHKLATNRRQKVIGLAPTHKAVSELRSKGYTEV
YTVKGFLYNRKKNFMQGSLIVVDEAGMVGTKAYAELFRVVRNNNCQLILAGDEKQLASIE
RGGMFEMLSNIFGSHVLVNIRRQSKNWSREAATKFAESNILSCITLLRQNKCVRFDNTLQ
DSMSKLIYNWSLSKFKPHEKLVITVRNKDVDILNSSIRSLLKANGTLKGTEYERSIDGRK
KSYMAGDRIVFQKSYKDLQIQNSEFATLTSVSKNKFIAKTDTGKEVSFDSVKYNLNMAMQ
VLFIRSRELL
NT seq 2013 nt   +upstreamnt  +downstreamnt
gtgagaattggtattgagatggctatacagtttacaaggattgaatttttaactagaagt
aaaggaggtgatagttgtcgtaaggcagcttataatgcaagaactattgttgaaaacgag
aagacaggtataaagtataacttctctcgtaagaaagataacgtatatcatacagtgctg
ataccggattatataaatcaagaattcaagaatattcaaacattaatgaatgaggtagaa
cgaaccgcaaaaaaccaaaaaaacagccagttgttgaaggatatagtaatagcattgcca
gacgagaaggagctaaatttagagcatagaatagaaataactcatcaaatagttgatgcg
atggaatgggtgcaaaatggtcttggagtacagatagatattcataagcctcatacagga
gataaaaactggcatgcacatatattgcttactataagaagatttagagaagatggaact
ggtttaggagatatagcagtagatttaaacccaaaaattataacattaagtaatggcaaa
aaggttgttattaaagatccagagatgattcatgaaatagtaaaagacataattaatgca
tatttcgctaaattaggcttaccatatagagttgacgagataagcgaagtgcctggagag
catatggggcgtattaaaattaggagtttaattaataaagtagtaaatgaaaatgagtta
cgtaaagaggctcatttgaagattattaatgatgctgacgtaataacagattctataaca
cattacaaatctatttttactaagcaggatattgaaaaagcagtaaaagatataccagat
ctaacagcaagagaacagttagttcagcaagtgcttagttcaaatagaatactagagtta
taccatgatgatggtgaaagtagcaaatattttacgacaattgaggttcgaaatgaggag
acgagaataatcagaatagctaataaaatcaatgatcaggtttattacaacgatatttac
aatcttaaaagtgatatcgaaggtctagcaaatgttagtgaagaacagaaacaagctcta
aggcatattttgcttagcactagtggagttagagtcttgagaggaagagctggtacagga
aaatcttatgttttaataaaagcgcataagctcgcaacaaatcgtagacaaaaagttatt
ggtcttgctcctactcataaggcagtatcagagctgaggagcaaaggttatacagaggtc
tatacagtaaaaggatttttgtataatcgaaaaaaaaattttatgcaaggcagcttaata
gtagtagatgaagctggaatggtaggtactaaagcttatgcagagctgtttagagtagtt
agaaacaataattgtcaactgatacttgctggagatgaaaagcagttagcttcaatagaa
agaggtggaatgtttgagatgctgagtaatatttttggttcacatgttttagtaaatatt
cgaagacaaagtaaaaactggagcagagaagcagcaacaaagtttgctgagagtaatatt
ttaagctgtataaccttactgaggcaaaataaatgcgttaggtttgataatacgttgcag
gactcaatgagtaaattaatatacaactggagtctaagcaaatttaaaccacatgaaaaa
ttggtaattacagtacgtaataaagatgtcgacattcttaattcaagtattaggtctttg
ttaaaagcaaatggtacgctaaaaggcacagaatatgagcgttctattgatggaaggaaa
aagtcatatatggcaggagatagaatcgtatttcaaaaaagctataaggatttacaaata
caaaacagtgaatttgcaactttaacttcggttagtaaaaataaatttatagctaagaca
gacacaggaaaagaagtgagttttgattcggtaaaatacaatttaaacatggctatgcaa
gtactgtttataaggtccagggagcttctataa

DBGET integrated database retrieval system