KEGG   Orientia tsutsugamushi Ikeda: OTT_1928
Entry
OTT_1928          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TraD
Organism
ott  Orientia tsutsugamushi Ikeda
SSDB
Motif
Pfam: TraD DUF3847
Other DBs
NCBI-ProteinID: BAG41386
UniProt: B3CQB7
Position
1962887..1963342
AA seq 151 aa
MANLMQQKITLQQKKARLIMDEVNLKIKERKMRTRRLIEMGGLVAKANLDHLSANTLFGA
IVSLKETLTQHPNVQDHWTTIGKDIFDKEQQNKAAVILKFASEPDEDTKRYIRLHGLKWN
SFRQEWCGHVKDIEALKNSLLNVQYSIELVV
NT seq 456 nt   +upstreamnt  +downstreamnt
atggcaaatcttatgcagcaaaaaattactcttcaacaaaaaaaggctaggctaatcatg
gatgaggttaaccttaaaattaaagaacgtaaaatgcgtactcgacgtcttatcgaaatg
ggtggattagttgctaaagctaatcttgatcacttatcagcaaatactttatttggtgca
attgtttcactaaaagaaactttaacacaacatccaaatgttcaggatcattggactaca
ataggtaaagatatttttgataaagaacagcaaaataaagctgctgtgattttaaaattt
gcctctgaaccagacgaagacactaagcgctacattcgccttcatggcttaaaatggaat
agctttcgtcaagaatggtgcggccatgttaaggacattgaggccttaaagaatagcctt
ctcaatgttcagtatagtatagaacttgtagtgtga

DBGET integrated database retrieval system