KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112218269Help
Entry
112218269         CDS       T05605                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha-like
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
otw04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112218269
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112218269
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     112218269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd C2 PX DUF4135
Motif
Other DBs
NCBI-GeneID: 112218269
NCBI-ProteinID: XP_024234687
Position
19
AA seq 1723 aa AA seqDB search
MAQISSGNGFKLDVAQPKGVVGKEEALRMEAEALAKLQMEKRQTLPATSSSTSSASSQNK
LHPAAAPRPTPSSSNRPEKDLIVFPEAKKQVEKDKFRDIDVDKLTNQELEKLLLDDSFGA
NSSKASRPSLLLGFNLSASYPGGHVTCSPSPFHSGQWTPSMLSTPSSLGVSTPTHQQAPM
FPSAPFPNPENFSFHNGFSPAMPPYIGLPGPQTSFMAFTPIQQPGAMVFQQPTVTLEMAK
LFDKIHSTSEYLKNGRSASTDLDSSSTSIASLAPNPPQPAVESPAFSRFEWLDLDPLNKR
KAEGEEGSSLASRGTVMVVGGPAGGDPWDAVLLDETEGVADGSSPPVEVTGQLAGRSQPR
RLSTGAAVTRNHSLTIPASSSQQKPNNQHDKGSGRALAKYTALEEKEAQNLEVVAFCEDV
AILRSKFAHDDLHTNPGYVLSAVIPQRDGGGDNGCSVKVSIEISESQEPVTFTCDVSSPV
ELLIMQALCWVHDDLNQVDISSYVLKVCGQEEVLQNKHSLGSHEYVQNCRKWEAEIKLQL
LSQSTMRRDLARTVEDDTSQVDLERHLGQVERPFKENVTRQGLADYLEGYHNQVNICLQN
ESTQYKTVDRVVQTVKNLCCALDEVETQAITEAVRRVKRSVNLPRTRSPEVGSKSSANGQ
LSPVEECMGFLTDAVYDLAQLYLRSFCPVSSSSPDPSNSQHTEGESAAEGRGSKEASGTT
DHLQFTLFAMHGIPAVWVSSYEKYYLMCALTHNGKNLFKPIQSKKVGTYKSFFYHIKWDE
MINFPMAVSLLPLESMLTLSLFGVLNQNASGSPDSNKQRKGPEVLGKISLPLFDFRRVLA
RGTKLLCLWTSPQAASAAAGIRRKNLAERIILQVDFPSPAVDVLYVGPQESPCPDPNTLE
ELDPDLHRRVEKLCCRASTFGLTRADRQLLWDQRHHCRAHTHSLPKVLASAPSWDWGSMA
EIHALLHNWPSLPPVCALELLDSKFADTEVRSVAVSWIESSSDDELADYLPQLVQALKFE
CHLKNALVIFLLSRAQGNVNITLYLYWLLRDAVQDPAFGRRYDQVLGALLCLCGAGLRAE
LDKQTRLVTLLGALAEKVRQAGGYARQVVLQEGLERVQSFFQRNSCRLPLSPSLEAKQLN
IKSCSFFNSNAVPLKLALVNADPLGEEINVMFKVGEDLRQDMLALQMIRIMDRIWLQEGL
DLRIVNFKCISTGKDKGMVELVPSSDTLRKIQAEYGVTGSFKDKPLAEWLRKYNPAEDEY
EKASENFIYSCAGCCVATYVLGICDRHNDNIMLRSTGHMFHIDFGKFLGHAQMFGSFKRD
RAPFVLTSDMAYVINGGERPTSRFQLFVDLCSQAYNLIRKHSGLFLNLLSLMTLSGLPEL
TGAQDLKYVYDALQPQTTDAEATIFFTRLIETSLGSVATKFNFFIHNLAQMRFSGLPSND
EPILSFSPKTYTLKQEGRIRDASIFSFQKRYNPDKHYVNLCGVREGQSEAQFLLRTFDEF
QELHNKLCILFPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYVHNLLRSSTEVTQCDL
IYTFFHPIARDDKTEGFEAMAKAPEAPPLSPTSGRVEGEVKLSVSYRNSTLFIMVMHIRD
LVTEEETDPNPYVKTYLLPDPHKTSKCKTKISRKTRNPTFNEMLVYSGYSKETLGLRELQ
LSVLSAESLRENCYLGGVTLKLKDFDLSKETVNWYKLTAVPYF
NT seq 5172 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatatccagtggtaatgggttcaagctggatgtggcccagccaaagggggtt
gtgggtaaggaggaggcccttcgtatggaggcggaggccttagccaaactacaaatggag
aagagacagacgctcccggcgacctcgtcttccacctcttctgcttcctcacaaaacaaa
cttcatcccgccgctgctcccaggcccactccttcctccagcaaccgaccggagaaggat
ctcatcgtcttccccgaggccaagaagcaggtagagaaggacaagttccgggacatcgac
gtcgacaagctgaccaaccaggagctagagaagctcctgctggacgacagcttcggggcc
aacagcagcaaggcctcgcggccctccttgctgctggggttcaacctcagcgcttcttac
ccggggggccacgtcacctgcagcccctcgcccttccacagcggccagtggacgccctcc
atgctctccaccccctccagtttgggcgtgtccacacccacccaccagcaggctcccatg
ttcccttctgctccgttccctaaccccgaaaacttctccttccacaatggcttttcaccg
gccatgccgccctacataggcctgcccggcccgcagacctcattcatggccttcactccc
atccagcagcccggggctatggtgttccagcagcccaccgtcaccctggagatggccaag
ctcttcgacaagatccacagtacctcggaatacttgaagaacggcaggtcggccagcact
gacctggattcttcgtcgaccagcatcgcgtccctggcgcccaacccaccgcaacctgcc
gtggaatcccctgctttcagccgcttcgagtggctggacctggacccactcaacaagcgc
aaagctgagggcgaggagggctcctccctggcatcgcgcggtacagtaatggtggtggga
ggaccagctggaggggacccctgggatgccgtgctgctcgacgagacagagggcgtggct
gatggcagcagtccacccgtggaggtgacgggtcaactcgcgggtcgctctcagccccgg
aggttgtcgacgggggcagcggtcaccaggaaccactcccttaccatcccagcgtcctca
tcccagcaaaagccaaacaatcagcacgataagggaagtgggagggcactggcaaagtac
accgccctggaggaaaaggaagcccagaacctggaagttgtagccttctgtgaagacgta
gcaatactgaggtcaaagttcgcccacgatgacctccacaccaacccggggtacgtgctg
agcgcggtgatcccccagagggacgggggaggggacaacggctgcagcgtcaaggtgtcc
atcgagatctctgagtcccaggagcctgtcactttcacctgcgacgtgagttctcctgta
gagctcctcatcatgcaagccctgtgttgggtccacgatgacctcaaccaggtggacatc
agcagctacgtcctcaaggtctgcggccaagaggaggtgctgcaaaataagcacagcctg
ggcagccacgagtacgtacagaactgcaggaagtgggaggcagagatcaagctccagctg
ctctcccagagcaccatgagaagggatctggcacgaacggtggaagacgacacctctcag
gtggacttggagaggcacttgggccaagtggagaggccgttcaaggagaacgtcaccaga
caaggcctggccgactatctggaaggctaccacaatcaagtcaacatctgcctgcagaat
gagagcacccagtataagacggtggatcgggtggtgcagacagtgaagaacctctgctgt
gccctggacgaggtggagacgcaggccatcacagaagcagtgagaagggttaagcgttct
gtcaacctccccaggacacgctcgccagaggtgggctccaaatcctcggcaaatggtcag
ctcagccccgtggaggagtgcatgggcttcctaacggacgctgtctacgacctggcccag
ctgtacttgcgctccttctgccccgtctcctcctcttcccccgacccctccaactcccag
cataccgagggggagtctgctgcggagggacgtggcagcaaggaggcctcgggcaccacg
gaccatctgcagtttaccctgttcgccatgcacggcatccccgccgtctgggtcagcagc
tatgagaagtactacctgatgtgtgctctgactcacaacggcaagaacctgttcaagccc
atccagtccaagaaagtgggcacctacaagagcttcttctaccacatcaaatgggacgaa
atgatcaacttcccaatggcggtgtccctgcttccattagagtcgatgctgactctctcc
ctctttggggtcctgaaccagaacgccagcggctccccagactccaacaaacagcgcaaa
ggaccagaagtgctgggcaaaatctccctgcccctatttgacttccgacgggtgctggcg
aggggaaccaagctgctgtgtctgtggacctctcctcaggctgcctctgctgcagccggg
atccggaggaagaacctggctgagaggatcatactgcaggtcgacttccccagcccagca
gtggacgtgctgtacgtggggccccaggagagcccctgccctgaccccaacaccctggag
gagctggaccctgacctgcaccgccgggtggagaaactttgctgccgagcctctaccttc
gggttgacgcgggctgaccgccagctgctgtgggaccagcggcaccactgccgagcccac
acccacagcctgcccaaggtgctggccagcgcccccagctgggactggggcagcatggct
gagattcacgccctcctccacaactggccctcactcccacccgtctgtgccctggagctg
ctcgactctaagtttgctgacacagaggtgaggagtgtggctgtcagctggatcgaatcc
agcagtgatgacgaattggccgactacctgcctcagcttgtgcaggcgctgaagtttgag
tgtcacctgaagaacgccctggtgattttcctgctgtccagagcacagggcaacgtcaac
atcaccctttacctgtactggctactgagggatgcggtgcaggacccagcgtttggccgg
aggtacgaccaggtgctgggggccctgctttgtctgtgtggggccggcctccgggccgag
ctggacaaacagacccgcttggtcactctgctgggggcgctggccgagaaggtccggcag
gccgggggctacgcacgacaggtggtgctccaggaaggtctggagagggtgcagtcattc
ttccagaggaacagctgcagactgcccctcagccccagcctggaggccaaacaactcaac
atcaagtcgtgctccttcttcaactccaatgcggtgcccctgaagctggccctggtgaac
gctgaccctctgggagaggagatcaatgtcatgttcaaggtgggagaggacctgcggcag
gacatgctggctctgcagatgatccggattatggaccgcatctggcttcaggagggactg
gacctgcgcattgtcaacttcaaatgcatctccactggcaaagacaaaggtatggtggag
ctggtgccgtcctcagacaccctgaggaagatccaggcggaatatggcgtgacgggctcc
ttcaaggacaagcccctggcagagtggctccgcaagtacaaccctgctgaggatgagtac
gagaaggcgtcggagaacttcatctactcgtgtgcgggctgctgcgtggccacctacgtg
ctgggtatctgcgaccgccacaacgacaacatcatgctgcgctccaccggtcacatgttc
cacatcgacttcggcaagttcctgggccacgcccagatgttcggcagcttcaaaagggac
cgtgctccatttgtgctgacctctgacatggcctacgtgatcaatgggggggagaggccc
accagtcgcttccagctgtttgtggacctgtgctcccaggcctacaacctaatccgtaaa
cactcaggcctcttcctcaacctgctctcactgatgacgttgtcaggcctaccagagctt
actggagctcaggaccttaagtacgtgtacgacgcactgcagccccagaccaccgacgca
gaggccaccatcttcttcaccaggttgattgagaccagcctgggcagcgtggccaccaag
ttcaacttcttcatccacaacctggcccagatgcgcttctctggcctgccgtccaacgac
gagcccatcctctccttctcccccaagacctacacgctgaagcaggagggacgcatccgc
gacgcctccatcttctccttccagaagagatacaaccccgacaagcactacgtgaaccta
tgtggtgtgcgagaggggcagagcgaggcccagtttctcttacgcaccttcgacgagttc
caggagctccacaacaagctgtgcatcctcttccctctgtggaagctgccagggttccct
aataggatggtgctgggccgtacacacatcaaggacgtggcggccaagaggaagattgag
ctcaacagctatgtccacaacctgttgaggagctccacagaggtcacccagtgtgatctt
atctatacattcttccatccgatcgcgagagacgacaagacggaaggattcgaggcgatg
gccaaagcaccagaggcgccaccattgagtccaacctcaggcagagtggagggggaggtg
aagctgtctgtttcctacaggaacagcacactcttcatcatggtcatgcacatccgagac
ctggtaactgaggaggagacagaccctaacccttatgtgaaaacctacctgctcccagac
ccccacaaaacctccaagtgcaaaacaaagatttccaggaagaccaggaaccccactttc
aacgaaatgctggtgtacagtggctacagcaaggagacccttggtctgcgggagctgcaa
ctgagcgtgcttagtgccgagtcgctgagagagaactgctacctgggcggcgtcacgctc
aaactcaaggacttcgacctcagcaaggagacggtcaattggtacaagctgaccgccgtg
ccctacttctag

DBGET integrated database retrieval system