KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112220161
Entry
112220161         CDS       T05605                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00230  Purine metabolism
otw00240  Pyrimidine metabolism
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112220161 (dck)
   00240 Pyrimidine metabolism
    112220161 (dck)
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     112220161 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 112220161
NCBI-ProteinID: XP_024237609
Position
20
AA seq 263 aa
MSPTPPKRAGPSLLNDTMDKTKRISIEGNIAAGKSTFVRLLEEQSKDWEVVPEPIARWCN
VQTQHSEFEELTMSQKSGSNVLQMMYEKPERWAYTFQTYACMSRVRAQMKSTNGKLREAE
NPVQFFERSVYSDRYIFAANLYESECLNETEWSIYQDWHGWLHKQFGKHIELDGIIYLRA
APERCMERLHRRGREEEQGIPLEYLEKLHFKHESWLQQKTMCMEYKYLNNVPILTLDVNE
DFKVDQVKGADMVEKVKEFLSTL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtcccccacgccgccgaagagagcaggtcctagtctcttaaacgacactatggacaag
accaaacgaatttcaatagaaggcaacattgcggcgggcaaatctacattcgtgcgcctt
ctggaagagcagagcaaagactgggaagtagtgcccgaacccatcgccaggtggtgcaat
gtacaaacacaacacagcgagtttgaggagctgaccatgtcccagaagagtggtagtaac
gtgctgcagatgatgtatgagaagccagagagatgggcctacaccttccagacctacgct
tgcatgagcagggtccgcgcccagatgaaatccaccaatgggaagctcagagaggcagag
aaccctgtgcagttcttcgagcgctccgtctacagtgacaggtacatctttgcggcaaac
ctgtatgagagtgagtgtctgaacgagacagagtggtccatctaccaggactggcacggc
tggctccataaacagtttggaaaacacatcgagctggatggcatcatctacctccgagcc
gcaccagagagatgcatggagaggctgcatcggagaggcagagaggaggagcagggcatt
ccactggagtacctggagaaacttcacttcaaacatgagagctggctgcagcaaaaaacc
atgtgcatggagtataagtatttgaataacgtgcccattctgacgctagatgttaacgaa
gatttcaaagttgaccaggtcaagggtgcggacatggtggaaaaggtcaaagagtttctc
agtaccttgtaa

DBGET integrated database retrieval system