KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112221612Help
Entry
112221612         CDS       T05605                                 

Definition
(RefSeq) GPI transamidase component PIG-T-like
  KO
K05292  GPI-anchor transamidase subunit T
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    112221612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16 GKAP
Motif
Other DBs
NCBI-GeneID: 112221612
NCBI-ProteinID: XP_024239555
Position
22
AA seq 694 aa AA seqDB search
MAAHRCNIFMLVFVLCGLTYVFVRADIEDTNHVKDAESVAVDIAPKANIGASLRSTKTED
QTQAAEEERQWEAETNPADAPSDNKADHVHDTMQNLDSRPAPYAKDQTQEAAEEERQWEA
TEVKEADRVPDTMQTPDVPPLTPAKDQFQEELVIRPLHSGDIYASFQFRTMWDTDFLRGS
KVSHYRLFPKSLGQVISKFSVRELHISFTQGYWRTMQWGQPFLPSPPGAELWVWFQDTVT
DVDGAWKELTNVLSGIFCASLNFIDSTNTVQPSASFKPLGLGNVTDQRFLRYAVLPREIV
CTENLTPWKKLLPCGSKAGLAVLMKSEKLFHSSFHSQALHFRPVCQDWKCKSTVWELRQT
LNVVFDLHTSGQGKREWSLFKMFSRTVTEACPLASSSKVYVDVTDNPQGELFELSPTTPL
LSQAVVLGDRRTYSVYDLTNQATFGQTRSLNMLLRWRAAESGDMLRPLLHGERYVAGYGL
QTGEIHTLMYNNHPYRAFPVLLLDTVPWYLRLYIHTLTVTSKGRDNKPSYIHYQPSKDRL
RPHLLEMLVQLPPNSVTEVTMQFERALLKWTEYTPDPNHGFYVGSSVISALVPSVVAMDT
NSTRECPLFSSFFPCKEESSYFMRVYTEPLLVNLPTPDFSMPYNVICLTCTVVAVGYGSL
YNLLTRTFQVEEPSPGLAKRLANIIRRLRGVPLL
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgcacaggtgcaatatttttatgctggtgttcgttctttgtggattaacatat
gtgtttgttagagcggacatagaagacacaaatcatgtgaaagatgctgaaagcgtggcc
gttgatattgcaccgaaggcgaatataggcgcgtcactgcgatcaactaaaaccgaggac
caaacccaggcagctgaagaggagaggcaatgggaggccgaaacgaatcccgcagatgcc
ccaagcgacaacaaagctgaccatgtccatgataccatgcaaaaccttgacagtcgtcca
gcaccgtatgcaaaagaccaaacccaagaggcagcggaagaggagaggcaatgggaggct
accgaggtcaaagaagctgaccgtgtccctgacaccatgcaaaccccagacgtccctcca
ctaacgcccgcaaaagatcagtttcaggaagagttggtgatcagaccattgcattctggg
gatatctatgccagcttccagttccgcaccatgtgggatacagacttcttacgaggaagt
aaagtctcccactaccgactcttcccaaagtcgctgggccaggtgatttcaaagttctct
gtgcgtgagctccacatctccttcactcagggctactggaggaccatgcagtggggccag
ccattcctaccatcgccccctggtgctgaactgtgggtatggttccaggacactgtcact
gatgtggacggtgcctggaaggagctgaccaacgttctctcagggatcttctgtgcctcc
ctgaacttcattgactccaccaacacagtgcagcccagtgcctccttcaaacctcttggc
ttgggcaacgtaacagaccagcgcttcctccgctatgctgtgttgccgcgggagatcgtc
tgtactgagaacctgactccgtggaagaaactcctcccctgtggctccaaggctggtctg
gcagtcctgatgaagtctgagaaactcttccacagcagcttccactcccaggctctacac
ttcagacctgtgtgtcaggactggaagtgcaaatccacagtgtgggagctgagacagaca
ctgaacgtggtgttcgacctgcacacctctggccagggcaaacgagagtggtccctgttc
aagatgttctctcgcaccgtgactgaagcctgcccgctggcctcctccagtaaagtgtac
gtggatgtcacagacaaccctcagggagagctgtttgagctgagcccaaccactcccctg
ctcagccaggctgtggtgcttggggaccggagaacctactcggtctatgacctcactaac
caggccacgttcggacaaacgcgctccctcaacatgctgctgcgctggcgagcagccgag
agtggagacatgctgcgtcccctgctgcatggagagcgctacgtggccggctacgggctg
cagacgggagagatccacaccctgatgtacaacaaccacccataccgggccttccccgtg
ctcctgctagacactgtgccctggtacctgcgcctctacatccacacgctcactgtcacc
agcaagggccgtgacaacaaacccagctacattcactaccagccgtccaaggaccgcctt
cggccccacctgctcgagatgctggtccagctgccccctaactctgtgaccgaggtgacc
atgcagtttgagagggcactcctcaagtggaccgagtacacccccgaccccaaccatggc
ttctacgtcgggtcttctgttatcagcgctctcgtgcccagtgtcgttgccatggatacc
aacagcactcgggaatgcccacttttcagcagctttttcccctgtaaagaggagtcaagt
tacttcatgcgggtctacacggaacccttgctggtgaacctgcccacccctgacttcagc
atgccctacaacgtcatctgcctcacttgcactgtggtggccgtgggttacggttccctc
tacaatctcctgacccgcaccttccaggtggaggagcccagtccgggcctggccaaacgg
ctagccaacatcatccgcaggctacggggtgtgccactgctgtga

DBGET integrated database retrieval system