KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222739Help
Entry
112222739         CDS       T05605                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw03040  Spliceosome
otw04010  MAPK signaling pathway
otw04141  Protein processing in endoplasmic reticulum
otw04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:otw00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112222739
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112222739
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112222739
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112222739
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:otw01009]
    112222739
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:otw03041]
    112222739
   03009 Ribosome biogenesis [BR:otw03009]
    112222739
   03110 Chaperones and folding catalysts [BR:otw03110]
    112222739
   04131 Membrane trafficking [BR:otw04131]
    112222739
   03051 Proteasome [BR:otw03051]
    112222739
   03029 Mitochondrial biogenesis [BR:otw03029]
    112222739
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:otw04147]
    112222739
Protein phosphatases and associated proteins [BR:otw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112222739
Spliceosome [BR:otw03041]
 Complex B
  Other components
   Prp19 complex
    112222739
 Complex C
   Prp19-CDC5 complex
    112222739
Ribosome biogenesis [BR:otw03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112222739
Chaperones and folding catalysts [BR:otw03110]
 Heat shock proteins
  HSP70 / DNAK
   112222739
Membrane trafficking [BR:otw04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112222739
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112222739
Proteasome [BR:otw03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112222739
Mitochondrial biogenesis [BR:otw03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112222739
Exosome [BR:otw04147]
 Exosomal proteins
  Proteins found in most exosomes
   112222739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 CRIC_ras_sig CENP-X
Motif
Other DBs
NCBI-GeneID: 112222739
NCBI-ProteinID: XP_024241239
Position
23
AA seq 651 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRKFDDAVVQSDMKHWPFTVVSDGGKPKMEVEYKGERKTFFPEEVS
SMVLTKMKEISEAYLGKPVNNAVITVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAA
IAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIGEFKRKFKKDISGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGADFYTSITRA
RFEELNADLFRGTLEPVEKSMRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDLFNGRDLN
KSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSENQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLTKEDIERMVQEADQYRAEDEAQKEKVTAKN
SLESLAFNMKSTVDDEKLAEKISPEDKKTIMDKCNEVISWLDRNQTAEKDEYEHQQKELE
KVCNPIITNLYQGTGGPPGGMPGGMPGGMPGGMPGGAGAGSSSGPTIEEVD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggaccagcagtaggcattgacctggggaccacatactcctgtgtgggcatc
tttcagcatggcaaggtggagatcatcgccaacgaccagggcaacagaaccacacccagc
tatgtggccttcaccgacacagaaaggctgatcggtgacgccgccaagaaccaggtggcc
atgaaccccaccaacactgtgttcgatgccaagcgtctaattggtcgtaagtttgatgat
gccgtggtacagtcggacatgaagcactggcccttcacagtggtgagcgatggtggcaag
cccaagatggaggtagagtacaagggagagaggaagacctttttccctgaggaggtgtcc
tccatggtgctcaccaagatgaaggagatctctgaagcttacctgggcaagccagtgaac
aatgctgtcatcacagtccctgcctacttcaacgactcccagcgccaagcaacaaaagat
gctggagtgatctctggactcaacgtcctgcgcatcatcaacgagcccactgctgcagcc
atcgcctatggcctggacaagaaggtcggcggtgagcgcaacgtcctgatcttcgacctg
ggcggcggcacctttgacgtgtccatcctgaccatcgaggatggcatctttgaggttaag
tccactgctggcgacacccacctgggaggcgaggacttcgacaaccgcatggtcaaccac
ttcatcggtgagttcaagcgtaaattcaagaaggacatcagcggcaacaagcgggcggtg
cggcgcctgcgcactgcctgtgagcgggccaaacgcaccctctcctccagcacccaagcc
agcatcgaaattgactctctctatgagggtgccgacttctacacctccattaccagggct
cgctttgaggagctcaacgctgacctgttccgcggtaccctggaacctgtggagaagtct
atgagggatgccaaaatggacaaggcccagatacacgacatcgtcctggtgggaggctcc
acacgtatccccaagatccagaagcttctgcaggacctattcaatggccgagacctcaac
aagagcatcaaccctgatgaggctgtggcttatggtgccgctgtgcaggctgccatctta
gcgggtgacaagtcagagaacgtgcaggacctgctgctgctggacgtcacacccctgtcc
ctgggtattgagacagccggaggggtcatgaccgtgctcatcaagaggaacaccaccatc
cccaccaagcagacccagaccttcacaacatactcagaaaaccaacccggagtgctcatc
caggtgtatgagggggagagagccatgaccaaggacaacaatatcctcggcaagtttgag
ctcactggaatcccccctgcccccaggggcgtcccccagatcgaggtgacctttgacatt
gacgccaacggcatcctcaatgtgtctgcggtggacaagagcaccggcaaggaaaacaag
atcaccatcaccaatgacaaaggacgtctgaccaaggaggacattgagcgcatggtgcaa
gaggctgaccagtacagggctgaggacgaggctcagaaggagaaggtcacagctaagaac
tcactggagtccctggcctttaacatgaagagcacagtggacgacgagaagctcgcggaa
aagatcagcccggaggacaagaagaccatcatggacaagtgcaacgaagttatctcctgg
ctggacaggaaccagacagcagagaaggatgagtatgagcaccagcagaaggagctggag
aaggtgtgtaaccccatcattaccaatctgtatcagggtaccggcggcccaccaggaggt
atgccaggaggtatgccaggcggtatgccaggcggtatgcctggaggcgctggagctggc
tcttcctctggtccaaccatcgaggaggtggactaa

DBGET integrated database retrieval system