KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112222858Help
Entry
112222858         CDS       T05605                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1-like
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00230  Purine metabolism
otw01100  Metabolic pathways
otw04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112222858
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112222858
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112222858
Enzymes [BR:otw01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     112222858
Protein kinases [BR:otw01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   112222858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Peripla_BP_6 DIRP
Motif
Other DBs
NCBI-GeneID: 112222858
NCBI-ProteinID: XP_024241468
Position
23
AA seq 1075 aa AA seqDB search
MRMQGEKLLLVLLLLLGACLQWVQSGMSSRHRDSHRRPRDHRDHQQHGNITLAIILPQRN
TAYPWAWPRVGPALDRAINTINADPALLRGHHLGYVFENSENEEGICSESIAPLMAVDLK
FAHDPWAFIGPGCDYTSSPVGLFTTHWDIPMVTAGAPAVGFNGINMYPSITNTGPTHKKL
GKFGLHICKHFEWKEQVLLMFSDNKKDDRPCYFAVEGLYTELHLNNITSVDLVFEENTGP
VNYSDLLHNIKQDGRVVFVCCSPDTFRQLMVHFRRAGLPQEEYVFFYIDMFGLSLDSQNA
QPWARGDQDDLVAKEAFQSVKILTYREPQNPEYKDFVRDLKTDAKRMFNFTVEDSLMNII
SGGFYDGLMLYTHALNETMTSPEDRPVGKTVTRRMWNRTYNGVTGLVQIDENGDRETDFA
LWDMNDTNTSVFQIVLVYNGSQKKLRALPGMDIQWPGGAAPLDVPVCGFKNDNPACLART
ITIHQMVTIVVFFIIIIILTITVFIYRKLKLENELVAQLWRVSWEDIQMSNMEKVLRSAG
SKLTLSLRGSNYGSLLTGDGNFQVFAKTGYYKANIVAIKYINRKRIELTRNVLFELKHMR
DIQNEHLTRFIGACIDPPNICIITEYCPRGSLQDIMENESITLDWMFRYSLINDIVKGMA
FLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRTESNTDDAHAYYARKLWMAPELL
RLERPPPCGTQKGDVYSFGIILQEVALRHGAFYLEGEPLSPKEIMDRVALGEWPCLRPAV
NPQIHSQELGQLMQRCWAEEPTERPEFNHIKLLLRKQNRECSTNILDNLLSRMEQYANNL
EELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTA
ISAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIAR
MALALLNAVRTFKIQHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRLES
NGEALKIHVSAATRDVLQEFNCFQLELRGDVEMKGKGKMTTYWLLGESKNNESTS
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgcagggagagaaactgttgctggttcttcttctgctgctgggtgcctgtctc
cagtgggtccagtctggcatgtcctcccggcaccgtgattcacaccgacgccccagagac
caccgggaccatcagcagcacgggaacatcacgctggccatcatcctaccacagagaaac
actgcctacccctgggcctggccccgtgtgggtccggctctagaccgagccatcaacacc
atcaacgctgacccagcgctcctccgcggccaccacctgggttatgtgtttgagaacagc
gagaacgaagaaggcatctgctctgagtccatcgccccactcatggctgttgacctcaag
ttcgcccacgacccttgggctttcattgggccgggctgcgactacacctcctccccagtg
ggcctcttcaccacccactgggacatccccatggtaacggcgggcgccccagccgtgggc
ttcaacggcatcaacatgtacccgtccatcaccaacacgggccccacgcacaaaaagctg
ggcaagttcggcctccatatctgcaagcactttgagtggaaggagcaggtgctgctcatg
ttcagtgataacaagaaggatgaccggccgtgctacttcgctgtggagggcctctacaca
gagctacacttgaacaacatcacctcggtggacctggtgtttgaggagaacactggacct
gtcaactactctgacctgctccacaacatcaagcaagatggccgagtggtatttgtgtgt
tgctctccggacacgttcaggcagctgatggttcacttccggcgggcaggccttcctcag
gaggagtatgtttttttctacattgacatgtttggactcagcctggactcccagaatgct
caaccctgggccagaggggaccaagacgaccttgtcgccaaggaggccttccagagtgtg
aaaatcctgacctatagagaaccccagaaccctgaatataaagattttgtgagggacctg
aagacagatgccaagagaatgttcaactttacggtggaggactcactgatgaacataatc
tccggagggttctacgatgggctgatgctgtacacccacgccctgaacgagaccatgacc
tctccagaggacagacctgtggggaaaaccgtaacaaggaggatgtggaaccgcacctac
aacggtgtaacaggcctggtgcagatagatgagaatggggacagagagacagactttgct
ctctgggacatgaatgacaccaacaccagtgttttccagattgtgttggtgtacaacggc
tctcagaagaagctgagggccttgcctgggatggacatccagtggccagggggcgctgct
cctttagatgtgcccgtctgtggcttcaagaacgacaacccagcatgccttgcacgaacc
atcacaatccaccagatggtaacaattgtggtgttcttcatcattatcatcatcctcacc
attactgtcttcatatacaggaagctcaagcttgaaaatgaactggtggctcagctgtgg
agagtctcctgggaggatattcagatgagcaacatggagaaagtgctgcgaagcgcaggc
agcaagctcactctgtccctgagrggctccaactacggctccctattaacaggagatgga
aactttcaggtgtttgccaagacaggctattacaaggcgaacattgtggccatcaaatac
atcaacagaaaacgcattgagctcaccagaaatgtgctgtttgaactgaaacatatgcgt
gatattcagaatgagcacctgacccgcttcatcggagcctgtatcgacccccccaacatc
tgcatcatcacagagtactgtccccggggtagcttacaggacatcatggaaaacgagagc
atcacactggattggatgttcagatactctttaatcaatgacattgtcaagggcatggct
ttcctccacaacagtgtcattgtctcccacggcaacctgaagtcgtccaactgcgtggtg
gataaccgctttgtgctgaagatcaccgactacggcctgtccagctttcgcaccgagagc
aacacagatgacgcccatgcttactatgcccggaagctgtggatggccccagagctgctg
aggttggagagaccccctccatgtggcacacagaagggagacgtctacagctttggcatc
attctccaagaggtggcgctacgccatggagccttctatctggagggagagccgctcagc
cccaaagaaatcatggaccgggtagctctgggtgagtggccgtgcctgcggcctgctgtc
aaccctcagatccacagccaggagctgggccaactcatgcagcgctgctgggcagaggag
cctaccgagaggcccgagttcaaccacatcaaactgctgctacgcaaacagaacagggag
tgcagcactaacatcctggataacctgctgtcccgtatggagcagtatgctaacaacctg
gaggagctggtggaggagagaacccaggcctaccacgaagagaaacgcaaggctgaggcc
ctgctctaccagatactaccacattcagtggcggagcagctaaagagaggggagacagta
caggctgaggcctttgattcagtcaccatctacttcagtgacattgtaggcttcacagcc
atatcagctgagagcacacctatgcaggttgtgaccctgctcaatgacctctacacatgt
ttcgatgccatcattgacaactttgatgtttacaaggtggagaccattggtgatgcctac
atggtggtgtccggcctgccggtgaggaacgggaagctacacggccgagagatcgcccgc
atggccctggctctgctcaacgctgtacgcaccttcaaaatccaacaccggcctgaccag
cagctcaaactacgcattggcatccacagcggccctgtgtgtgcaggagtggtggggctg
aagatgccacggtactgtctgtttggagacacagtcaacacctcttcacgactggagtcc
aatggtgaagcattgaagatccatgtgtctgcggccacacgtgacgtcctgcaggagttc
aactgcttccagctggagctgagaggagacgtggagatgaaggggaaggggaaaatgacc
acctactggctactgggagagagcaagaacaacgagtcaacgagctaa

DBGET integrated database retrieval system