KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223438Help
Entry
112223438         CDS       T05605                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00010  Glycolysis / Gluconeogenesis
otw00562  Inositol phosphate metabolism
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112223438
   00562 Inositol phosphate metabolism
    112223438
Enzymes [BR:otw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     112223438
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     112223438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 112223438
NCBI-ProteinID: XP_024242219
Position
24
AA seq 461 aa AA seqDB search
MTTALSKQSLLFITFSLALTRFSYCSVANASVNSNIPAIANHFGTKGRYEEVNRYLINDI
LSVNKNKSILKPGCTNSTAIHVTAIIRHGTRYPSTKNIKMMQRLYDLVLNEAMNTDKWLK
EIKTKWEMWYTDDMDGKLVEKGRDDHRHLAVRLATLFPSLISEENLRAHRIRFITSSKHR
CVDSIVAFQEGLLNLWNVTEVGPSHKINDGLMRFFDQCQKFVEDVENNQTALEEVHLFKA
SAEMKRVQMKMADQLQMPYNRITPDLVEAAFFLCSYEFAIKSLNSAWCNLFDETDAQVLE
YKNDLKQYWKRGYGHDINRKSSCNLFHDLFNRFDQAAREIRFGHVSEAVTIQVGHAETLL
PLLALMGFFRDETALTADNFDVQNGRTFRTSRIVPYAANLLFVLYDCSEGLRLQFLLNET
PQNFPDIMHQAPLYDTVRETYRELLHGCNFEKECELPRPNS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgcgttatctaaacaaagtttgttgttcattacatttagtcttgctttgacc
aggttttcatactgctcagttgcaaatgctagcgtcaattcaaacatacctgcgattgca
aatcattttggaacgaaaggcagatatgaggaggttaaccgttatctcattaatgacatt
ctctcggtaaacaaaaacaaatccattttaaaaccaggatgtaccaatagcacggctatt
catgtgaccgccattattcggcatggtacacgatatccgtcgaccaaaaatataaaaatg
atgcaacggctttacgaccttgttctaaacgaggcaatgaatactgataaatggctgaag
gaaatcaaaaccaagtgggaaatgtggtacaccgacgacatggatggcaagcttgtggag
aaggggcgagatgaccataggcatctggctgtcaggttggcaacattgtttccatctctg
atatccgaggaaaaccttagagcccaccgtatccgtttcatcactagctctaaacacaga
tgcgtggacagcattgtagcatttcaagagggcctactcaacctttggaacgtgacagaa
gttggacccagccacaaaatcaacgatgggttgatgagattctttgatcagtgtcagaaa
tttgttgaggacgtagagaacaaccaaactgccctggaagaggtccacctcttcaaggcc
tcagcagagatgaaaagagtgcagatgaagatggctgaccagctgcaaatgccatacaat
cgcatcacaccagatctggtagaggctgcattcttcctgtgctcatatgagtttgccatc
aaatctttgaactccgcctggtgcaacctgtttgatgagactgacgcccaagtgctggag
tacaaaaatgacctgaaacagtactggaagaggggctatggtcatgatatcaaccgcaag
tccagttgcaatctctttcatgacctgttcaatcgttttgatcaggctgctcgtgagatc
aggtttggccatgtatctgaggctgtgaccatccaggtgggtcatgccgagaccctcctg
cccctgttggccctcatgggcttcttcagagatgagacggccctgactgctgacaacttt
gacgtgcaaaatggccgcaccttccgtaccagccgcattgtgccttatgcagccaacctg
ctctttgtgctatatgactgcagcgaaggactccggctacagttcctcctcaacgagaca
cctcagaacttccctgacataatgcaccaggctccactctacgatacggtcagagaaacc
tacagagagctgctgcacggctgcaattttgaaaaagagtgcgagctgccacgacccaac
tcctga

DBGET integrated database retrieval system