KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112223998Help
Entry
112223998         CDS       T05605                                 

Definition
(RefSeq) nucleoside diphosphate kinase A-like
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00230  Purine metabolism
otw00240  Pyrimidine metabolism
otw00983  Drug metabolism - other enzymes
otw01100  Metabolic pathways
Module
otw_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
otw_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
otw_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112223998
   00240 Pyrimidine metabolism
    112223998
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    112223998
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:otw04131]
    112223998
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     112223998
Membrane trafficking [BR:otw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112223998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 112223998
NCBI-ProteinID: XP_024243057
Position
25
AA seq 151 aa AA seqDB search
MSNEERTFIAIKPDGVQRRLVGEIIKRFELKGFKMVGMKFVQAPESLLREHYADLEDRPF
FPGLVSYMTSGPVVAMVWEGFNVVKTGRVMLGETNPADSKPGTIRGDYCIQVGRNIIHGS
DSIESANTEINLWFKPEELCSYTSCSTSWLY
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaggagcggactttcattgccatcaagccagatggagttcagaggaggctt
gttggcgaaatcatcaagcgatttgagctaaagggcttcaaaatggtggggatgaaattt
gtccaggccccggagtctctgctgagggagcactacgctgacctggaggacagacccttc
ttcccaggcctcgtcagctacatgacctcaggaccagtggttgccatggtgtgggaaggg
ttcaacgtggtgaagacaggcagagtgatgctgggagagaccaaccctgcagactccaaa
cccggcaccatccgaggggactactgcatccaagtgggcaggaacatcatccatggcagt
gactcaatagagagtgccaacacagagatcaacctgtggttcaaacctgaggagctttgc
agctacactagctgctctaccagctggctctactga

DBGET integrated database retrieval system