KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112225016
Entry
112225016         CDS       T05605                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:otw03021]
    112225016 (aff3)
Transcription machinery [BR:otw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     112225016 (aff3)
SSDB
Motif
Pfam: AF-4_C
Other DBs
NCBI-GeneID: 112225016
NCBI-ProteinID: XP_024244351
Position
26
AA seq 1138 aa
MKVCRAAHTHTWWEGGHSSSDSSGSDSYSELEEESSGQRSLSPSPKNTLRSWTPTDTQAP
GCTKEIYHPSTTQWQLDKWLKKVPQKSSSCDQDPSNHDHAQRATEHQSLSPDPHRAPSPS
RPWGIREDYSPSQSPVPSPRFNYSPRHSPRPSPGYSPCPSPSPCSSPCPSPTPRHSPIPS
PVLSVCPSPFPSPRATCSLSSIPQHPPRSPSPSLTHSSPRRYSQVRSPHQESHRPPTWPS
LTTSPSHRPKIRPWTAPVPSTEPKSKPRHSPYPQPPPQHSSRPKSTQTQHVPTPKTTAKA
APALTTELSHRHKHRPRPSPNSSPKLHSQPSLKHARTLDPKSQHLSTSGLRPKESSRHSH
NSNFNPRPSNGPSLTTRLSTSLSPTPRAKTLPTTDPSRETSSRVGHCSKSSPKPHSLPNS
KPSSEPHAKFSPSPRPKVKSWAPAPHSKLPQRKPQSREREQEVDNRRETHAPKRKVDRQT
EGKGEHEVERQTEKKGERQGKKQKERKGERQGERRLAEEQLLRRPWVQSSEEEEDVEERK
RRREEREKEKCKRRRKEQQQQSGEWQAVQPKQRPHTNSERRHHPIDPQRHGTKKKRRRKS
EEEEERQSQPDPSPPPSPSSPTPVVPPTDSSASSESDSEPDLPPNVTKVPADSTSSQRPI
PRRGYQGPGRPADSRPRVIYPRRTTASNPGQGHQIQGKQKLYTLVPFGRRELAAASHRGL
RNLVVQLDLSLLNRVPDTTTGTPASHKHSSSSASSKQKEAMRHLCIPETERGDSKRKRKS
ENGIQHHRESKRSNSQTNGPSAHTESTTHRRLDPHSDTRHNGFLEDYLDSTPLSDTLDPT
KPPIKTQNPEPKMEVECCVGVSGQSQPECEPWGPPLQRAGGQRGTVTNHEPPHHAEYYMH
EAKRMKHRADAMVDKLGKAVNYVDAALSFMECGKAMEEGPLEAKSPYTMYAETVELIRYA
MKLKNHSGPGARQEDQQLAVLCFRCLALLYWQMFRLKKDHALKYSKALLDYFKSSPKVPT
TPPIWSDSGKGTGGPPSSLSPSPSALTLGSHTGSSPSSLISIPQRIHQMAANHLNITNSV
LYSYEYWEVADSLARDNKEFFNYLNTLSGPLTLHSSIAHAVQYTRQALQWIRISANVG
NT seq 3417 nt   +upstreamnt  +downstreamnt
atgaaagtctgtcgggcagcacacacacacacatggtgggagggtggacattccagctca
gactcttcaggctcagactcctacagtgaattggaggaggagagcagtggccagcgctcc
cttagcccaagcccaaaaaacacactccgatcctggacacccaccgacactcaggcccct
ggctgcaccaaggagatatatcacccctccaccactcagtggcagctggataagtggctg
aaaaaagtcccccaaaaatcctcttcctgcgaccaggatcccagcaatcacgaccacgcc
cagagagctacagagcaccagtcgctctccccagacccccacagagctccatctccatcc
agaccctgggggatcagagaggactacagccctagccagagccctgttcccagcccgcgc
tttaactacagccccaggcatagccctcggcctagccctggctacagcccctgccccagc
cccagcccctgttccagtccttgtcctagccccaccccaagacacagccccatccctagc
ccggtcctcagtgtctgtccaagccccttcccaagccccagagccacctgcagccttagt
tccattccccagcacccccctaggagtcctagtcctagccttactcattctagcccccgc
cgctattctcaggttcggagtcctcatcaggaaagccacaggcctcccacgtggcctagc
ctaacaaccagcccgagccatagacccaaaatcaggccctggactgcccctgtacccagc
actgagcccaagagcaagccaagacacagtccatatcctcagcctccgcctcagcacagc
tccaggcctaaatccacacagacccagcatgttcccactcccaagaccacagccaaggca
gcccctgcactgaccactgagctgagccacaggcacaaacacagacccaggcctagtcct
aactcgagtcccaagcttcattctcagcctagcttgaaacacgcacgcactctagacccc
aaaagccaacacctatcaacctctggactaaggcctaaggagagtagcagacacagccat
aattccaacttcaaccccagacccagtaatgggcctagtttgacaaccagactcagtacc
agtctcagccccacacccagggccaagaccttacccaccacagaccctagcagagagacc
agcagcagagttggtcactgttccaaatccagcccaaagccacattctctgcctaactcc
aaacctagttctgagcctcacgctaaattcagccccagccctagacccaaagtcaagtcc
tgggcccctgctccccactcaaagcttccacagaggaagccccaatccagggagagagaa
caggaggtggacaaccggagagagacccatgcaccaaagaggaaggtagacaggcagaca
gagggaaagggggaacatgaggtagagagacagacagaaaaaaaaggagagaggcagggg
aagaaacagaaggaaagaaagggggagagacagggagagagaagactggcggaggagcag
ttgcttagacgcccctgggtccagagctcagaggaggaagaggacgtagaggagagaaag
aggagaagggaggagagagagaaggagaagtgcaagaggaggaggaaggagcagcagcag
cagagtggtgaatggcaggcggtccagcccaagcagagacctcacaccaacagcgagcgc
cgccaccatccaatcgacccacaacgccacgggaccaagaaaaagaggaggaggaagagt
gaggaggaggaagagagacagtctcagccggacccttcccctccgccatcaccctcctcc
cccactcctgttgtcccacccacggactcctccgcctcttcagagtccgactcggagccc
gatctgcctcccaacgtcaccaaagtcccggccgactccacatcaagccagcgtcccatc
cccaggagagggtaccagggcccggggaggcccgcggatagcaggcccagagtgatctac
cccaggcgcaccaccgcatccaacccaggccaggggcaccaaatccagggaaagcagaaa
ctctacaccctggtcccgtttggacgtcgtgagctggccgcagcctcccatcgaggcctg
agaaacttggtggtgcagctagacctctccctgctcaacagagtgcctgatactacgaca
ggcaccccagcctctcacaaacactcttcctcctctgcctcttccaagcagaaagaagcc
atgagacacctgtgcatccccgagacagagagaggagacagcaagaggaaacgcaagtca
gagaatggaatccagcaccacagagagagtaagaggagcaactcccagaccaacggcccc
tctgcccacacagagtctacaacgcacagacgtctagaccctcactcagacaccagacac
aacgggttcttggaggactatctggacagtacccctctctctgacaccctcgaccccacc
aagccccccatcaaaacacagaacccagagcctaagatggaggttgagtgttgtgttggg
gtgtcagggcagtctcagcccgagtgtgaaccatggggacctcctttacaacgggcaggg
ggacagagaggaaccgtaaccaaccatgaacccccacatcatgctgagtactacatgcat
gaagccaagaggatgaagcaccgtgcagatgccatggtggataagctggggaaggcagtg
aactatgtggatgctgctctctccttcatggagtgtggkaaagctatggaggagggacca
ctggaggccaagtctccctataccatgtacgcagagacagtagagcttatcaggtacgcc
atgaagctgaagaaccactctggcccaggggctagacaggaagaccaacagttggccgta
ctgtgtttccggtgccttgctctcctatactggcagatgtttcgtctaaagaaggatcac
gccctgaagtattccaaggctctattggactactttaagagttctccaaaagtgcctact
actcccccaatctggagcgactcgggaaagggcacagggggacctccctcgtccctctcc
cccagcccctcagccctcaccctgggctctcacactggcagctccccctcctccctcatc
agcattccccaacgtatccaccagatggcagcaaaccacctcaacatcaccaacagtgtc
ctctacagctatgagtactgggaggtagcagatagccttgccagagacaacaaggagttt
tttaactacttgaacaccctgtcggggccgttgactctccacagtagtattgctcatgca
gtccagtacaccagacaggctctacagtggatacgcatcagtgccaatgtgggttag

DBGET integrated database retrieval system