KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226775Help
Entry
112226775         CDS       T05605                                 

Definition
(RefSeq) rho-associated protein kinase 1-like isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04270  Vascular smooth muscle contraction
otw04350  TGF-beta signaling pathway
otw04510  Focal adhesion
otw04530  Tight junction
otw04810  Regulation of actin cytoskeleton
otw05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112226775
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112226775
   04530 Tight junction
    112226775
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112226775
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112226775
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112226775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112226775
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:otw03036]
    112226775
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112226775
Protein kinases [BR:otw01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   112226775
Chromosome and associated proteins [BR:otw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112226775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH HR1 C1_1 Cortex-I_coil APH Pkinase_C
Motif
Other DBs
NCBI-GeneID: 112226775
NCBI-ProteinID: XP_024247083
Position
28
AA seq 1385 aa AA seqDB search
MSAGESLEARFEKIDAMLKDPKSEINTDCLLDGLDALVYDLDFPALRKNKSIDNFLNRYK
DTISKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKATRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSAWVVQLFYAFQDDRCLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDGIHAMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKDGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFP
DDSDISKDAKNLICAFLTDREVRLGRNGVDEIKRHPFFKNDQWTWENIRDTAAPVVPELS
SDIDTSNFDDIEADRGDEETFPIPKAFVGNQLPFVGFTYYSSHQFSRSSSTKSVDKRSSS
TKEDKSHLENLQKRIYQLEEQLHSEMQLKDEMEQKCRASNTKLDKIMKELDEEGNVRKGV
EASMSLLEKDKMMIQHRATEYQRKADQEAEKRRNLENEVSTLKEQLEDMRKICQNSQASN
DKILQLQNQLEEANDLLRAESDTAARLRKSHTEMAKSMSQLEGLNRELQEKCRSSEGGRA
QLEKELLQLQSTLDSERRCYSQGSEEIHELQVRTTGLQEDNKNLKLCLSKVEAERKQAQE
RRNNLEKEKNNLEIDLNYKLKTLQQRLDQEHTEHRVTRAQLTDKYESIEEAKSAAMHAVQ
QKVSEESGARMRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEDEVKGLRMQLE
QESSKRLLAQNELKSRSQEADRLKGSEKQLKQEINAALESKRSLEFQLAQLTKQYRGNEG
QMRELQDQLEAEQYFSTLYKTQVKELKEDIEERNRQVQEVQKKVQELHSERDSLLAQLDL
TVTKAESEQLARALQEEQYFELSQENKKTTARHKQEGTEKDATIARLEDSNKTLTKDVEN
LSKEKAELNNKLCIQEEEYASQKEEITNAIKANYEKVLSTERTLKTQAVNKLAEIMNRKD
MKLDTKKKGNTTDLRKKEKENRKLQLELKQEKDKFNHMAIKYQKELSEMQAQLSEECTYR
NELQMQLDSKESDIEQLRERLNDLQLRMDNSSVTSLQMDETDSNIAESRLEGWLSIPNKP
NIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEE
IPRIFQILYANEGECRKEADMETVSQGDKTNCLPHKGHEFIPTLYHFPTNCEACAKPLWN
VFKPPPALECRRCHVKCHQDHLDKKEDVIAPCKVNYDVTSARDMLLLALTQDEQKKWIGH
LGKKIPKTPPSSFLRASPRTMSTRPAPNQSFRKNPKSITGKPRSQSHSATTASSLQAADA
TSSTC
NT seq 4158 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctggagaaagtttggaagctcgttttgagaaaatcgatgccatgttgaaggac
ccgaagtcggaaataaacacggattgccttttggatggcttggatgcgttggtgtacgac
cttgactttccagccttgaggaaaaacaaaagcatcgacaactttttgaatagatataag
gacaccatcagtaagatccgggacctgcggatgaaagcagaggactatgaggtggtcaag
gttatcgggaggggtgcttttggagaagtgcagttggtaagacacaaagccaccaggaag
gtgtacgccatgaagctgcttagcaagtttgaaatgatcaaaaggtcggactctgctttc
ttctgggaggagagggacatcatggcctttgccaacagcgcctgggttgtgcagctgttt
tatgcattccaggatgaccgttgcctctacatggtgatggagtatatgcccggcggagac
ctggtcaacttgatgagcaactatgacgtccccgagaagtgggcccgtttctacaccgct
gaggtggtgctggctctggacgggatccacgccatgggcttcatacacagggacgtgaag
cctgataacatgttgctagacaaagcgggccacttgaagttggcagactttgggacctgt
atgaaaatgaacaaggatggtatggtacgatgcgacaccgcagtgggaacaccagactac
atttcgccagaggtactaaaatcccagggaggagatggatattacggccgggaatgtgac
tggtggtccgtgggagtcttcctgtacgaaatgctcgttggtgacacaccgttctatgct
gactcgttggtggggacgtacagtaagatcatgaaccacaagaatgccctgaccttccct
gatgacagcgacatctccaaggatgccaagaaccttatctgtgccttcctgactgacagg
gaggtaagactgggtcgcaacggggtggatgagatcaagagacatcctttcttcaagaac
gaccagtggacatgggagaacatccgagacacagcggccccggtggtgcctgagctgagc
agcgacatcgacaccagtaactttgacgacatcgaggcggaccggggagacgaggagacc
ttccccataccaaaggccttcgtgggcaaccagctgccctttgtgggcttcacctactac
agcagtcatcagttttcccggagctccagcaccaagagtgttgacaaacgcagcagctcc
accaaggaagacaagagccatctggagaacctgcagaagaggatctaccagctagaagaa
caactccacagtgagatgcagctgaaggacgaaatggagcagaagtgcagggcctcgaac
acaaagcttgacaagatcatgaaagagctggacgaggagggcaacgtgaggaagggtgtg
gaggccagcatgtccctgctggagaaagacaagatgatgatccagcaccgagccaccgag
taccaaagaaaggccgaccaggaggccgagaagagacgcaacttggagaacgaggtgtcc
actctgaaggagcagcttgaggacatgaggaaaatctgccaaaactctcaggcctcgaat
gacaagatcctacagttacaaaatcagctggaggaggccaatgacctgctgcgggcagag
tcggacacggcggcgcggctgaggaagagccacacggagatggccaagtccatgagccag
ctggaggggctgaaccgcgagctgcaggagaagtgtcgttcgtctgagggggggagggcc
cagctggagaaggagctgctgcagctgcagagcacgcttgactctgaaaggaggtgctac
agccagggatcagaggagatccacgagctgcaagtgcggacgactggtcttcaggaggac
aataagaacttgaaactctgcttgtccaaagtggaggcggaacgcaaacaggcccaggag
aggagaaacaacctggagaaggagaagaacaacctggagattgacctgaactacaagctg
aagactctgcagcagcgtttggaccaggagcacacggaacacagagtgacgcgggcccag
ctcactgacaaatacgagtccattgaagaggccaagtcagctgccatgcatgcggtgcag
cagaaggtgtcggaggagagcggggcgaggatgcgagcggagagcagggtggtggaggtg
gagaagcagtgctccatgctggagtttgaccttaagcagtcagtgcagaagatggagcag
ctgatgaagcagaaggagaggctggaggacgaggtgaaaggtctacggatgcagctggag
caggagtccagtaagaggctgctggcccagaacgagctgaagagccgctcgcaggaggcc
gaccggctgaagggctcagagaagcagctgaagcaggagatcaacgcggcactagagagc
aaacggtcgctcgagttccagctcgcacagctcaccaagcagtacaggggcaacgaggga
cagatgagggaacttcaggaccagcttgaggccgaacagtatttctcaacgctttataaa
actcaggtgaaggaactgaaagaggatattgaggagaggaaccggcaggtccaggaagtt
caaaagaaggtgcaggagctgcacagcgaaagggactccctgttggcccagctggatctg
acagtgaccaaggcggagtcggagcagctggccagggcgctccaggaggagcaatacttt
gagctgagccaggagaacaagaagaccacggccagacacaagcaggagggcaccgagaag
gatgccaccatcgcacggcttgaggattccaacaaaactctgaccaaagatgtggagaac
ctcagcaaggagaaggccgagctgaacaacaagctttgcattcaggaggaagagtatgcc
tcccagaaagaggagattacaaacgcaatcaaggccaactacgagaaggttctcagcaca
gagcgcacgctcaagactcaggcggtgaacaagctggcagagatcatgaacaggaaggat
atgaagctggacaccaagaagaagggcaacacgaccgacctgaggaagaaggagaaggag
aaccgcaagctgcagcttgagctcaaacaggagaaggacaagttcaaccacatggccatt
aagtaccagaaggagctcagtgagatgcaggcgcaactgtccgaggagtgcacgtaccgc
aacgagctgcagatgcagctggacagcaaggagagtgacatcgagcagctgagggagagg
ctcaacgacctgcagctgcgcatggacaactccagcgtcaccagcctgcagatggacgag
acggacagcaacatcgccgaatccagactggaagggtggctgtccattcctaataaacct
aatatcaaacgatatggctggaagaagcagtatgtggtggtgagcagcaagaagattctg
ttctacaatgatgaacaggacaaagaacagtccaacccctccatggtactagatatcgac
aaactgttccacgtgcgtccagtcacccagggtgatgtgtaccgtgcagagaccgaggag
atcccaaggatattccagatcctgtatgccaatgagggggagtgcaggaaggaggcggac
atggagacggtctcgcagggcgacaagaccaactgcctgccccacaaaggtcatgagttc
atccccacgctttaccacttccccacgaactgcgaggcctgcgccaagcccctgtggaac
gtcttcaagcccccacctgccctggagtgccgccgctgccatgtcaagtgccaccaggac
cacctcgacaagaaggaggacgtcattgccccctgcaaagtgaactacgacgtgacctct
gcccgggacatgctcctgctagctctgacccaagacgagcagaagaaatggattggccac
ctgggcaagaagatccccaaaacaccgccctcctccttcctgagggcgtcgcctcgcacc
atgtccacccgccccgcacccaaccagtccttccgcaagaaccccaaaagcatcacaggc
aagccaaggtcgcagtctcattctgctaccacagcctccagcctccaagcagcagacgca
acatccagcacttgttga

DBGET integrated database retrieval system