KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112226995Help
Entry
112226995         CDS       T05605                                 

Definition
(RefSeq) cAMP-responsive element modulator-like isoform X1
  KO
K09052  cAMP response element modulator
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:otw00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112226995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112226995
Transcription factors [BR:otw03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112226995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf Rh5
Motif
Other DBs
NCBI-GeneID: 112226995
NCBI-ProteinID: XP_024247529
Position
28
AA seq 324 aa AA seqDB search
MTMDTEVASSKQEGRFDDSLSDEDPSQSESNSPTAVITQVSGTGDSAGMTVVQLPSGQTL
HVQGVIQAPQASVIQSPQMQNVQITSIAGLEDGESTATDTQKRREILSRRPSYRKILNEL
SSDSSSIPRIEEEKPEDEVPSSSVPAVQVPTSIYQTSSGQYIAITQGGAIQITSPGSEGL
QGVQTLAMSNSGTPQILQYATQAGDSGQQFFSVQGGQVVIQAATGDMPAYQLRSPTSSGL
PQGLVMAASPGSLSMHNPPVHTEEVTRKREVRLMKNREAARECRKKKKEYVKCLENRVAV
LENQNKTLIEELKALKDIYCHKNE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggacacagaggttgcgtcgtcaaagcaggagggacgttttgatgactctctg
tctgatgaggatccaagtcagagtgaatccaactcacccactgcagtaatcactcaggtt
tcaggaacaggagactccgctggcatgacagtggtgcagttacctagtgggcagacactt
catgttcagggtgtcatccaggctcctcaggcctctgtcatccagtcaccacagatgcag
aatgtacagataacctccatagctgggcttgaagatggggagtcaacagccacagacaca
cagaaaagaagagagattctctcaagacgcccatcttatcgaaaaatcctcaatgagcta
tcatcagattcctcctcaattccgagaatcgaggaagagaaacccgaagatgaggttcca
tcctccagtgtgcctgcagttcaagtgccaacttcaatctatcagaccagcagcggccaa
tacattgccatcacccaggggggagccatccagataaccagtccaggcagtgagggtctg
cagggcgtacagactctggccatgtccaactctggtacaccccagatcctgcagtatgca
acccaggcaggggactcaggacaacagttcttctctgtacaaggtggccaggtggtgata
caagctgccactggagatatgcccgcataccagctccgttcgcccacctcgtcgggcctg
ccccagggtctggtgatggctgcgtccccaggctccctgtccatgcacaatcccccggtg
cacactgaggaggtaacacgcaaaagggaggtccgcctcatgaagaacagggaggctgca
agggagtgccgcaagaaaaagaaagagtatgtcaagtgtctggagaaccgtgtggccgtg
ctggaaaaccaaaacaagaccctcattgaggaactcaaagcgctaaaggacatttactgc
cacaagaatgagtag

DBGET integrated database retrieval system