KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227836Help
Entry
112227836         CDS       T05605                                 

Definition
(RefSeq) TGF-beta receptor type-1-like isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw04010  MAPK signaling pathway
otw04060  Cytokine-cytokine receptor interaction
otw04068  FoxO signaling pathway
otw04144  Endocytosis
otw04218  Cellular senescence
otw04350  TGF-beta signaling pathway
otw04371  Apelin signaling pathway
otw04520  Adherens junction
otw04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:otw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112227836
   04350 TGF-beta signaling pathway
    112227836
   04371 Apelin signaling pathway
    112227836
   04068 FoxO signaling pathway
    112227836
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112227836
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112227836
  09143 Cell growth and death
   04218 Cellular senescence
    112227836
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112227836
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112227836
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:otw01001]
    112227836
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112227836
Protein kinases [BR:otw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   112227836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH Haspin_kinase DUF1923 FTA2
Motif
Other DBs
NCBI-GeneID: 112227836
NCBI-ProteinID: XP_024248541
Position
29
AA seq 497 aa AA seqDB search
MDAITRCLVLIVLFFGTRIQENDALQCYCQRCLNSTCTTDGLCFVSVRKSGSSITAESSM
CVPENELIPRDRPFICAPSTKDDTGIYPMCCATDWCNKNPDLSVFPVPTVKPVPLGPVAL
AAVIAGPVCVLCFVLMLVFYICHSRAGVHHRVPNEEDPSMNHPFLNVGSTLQDLIYDMTT
SGSGSGLPLLVQRTIARTIILQESIGKGRFGEVWRGKWRDEEVAVKIFSSREERSWFREA
EIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLS
LSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKSGTCCIADLGLAVRHDSATDTID
IAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIASRCSLAGIVEDYQL
PYHDLVQSDPSVEEMRRVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTAL
RIKKTLSQLSQSEGIKM
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaataacccgttgtctcgtgttaatagtcctgttctttgggactaggattcaa
gaaaatgatgccttgcagtgttactgccagcgatgtctcaactccacgtgcaccacggac
ggcctgtgcttcgtgtccgtcaggaagtctggcagcagcatcaccgccgagagcagcatg
tgtgtcccagagaacgagcttatcccgcgtgaccgccccttcatctgcgcaccctccacc
aaggacgacactggcatctaccccatgtgttgcgccaccgactggtgcaacaagaacccc
gacctcagcgtcttcccagtgccaacagtgaagccggttcccctggggcctgtggcgctg
gcagcggtcatcgcggggcctgtgtgcgtactgtgcttcgtgctgatgctggtcttctac
atctgccacagccgtgcgggcgtccaccaccgcgtacccaacgaggaggacccctccatg
aaccaccccttcctcaatgtgggctccactctccaagacctcatctacgacatgaccacc
tctggctccggctctggtctgcccctgctggtccagaggaccatagcccggaccatcatc
ctccaggagagcatcgggaagggccgcttcggcgaggtgtggcgggggaagtggcgagac
gaagaggtggcggtcaagatcttctcgtcccgtgaggagcgctcgtggttccgcgaggct
gagatctaccagacagtcatgctgcgtcacgagaacatcctgggcttcatcgctgctgac
aacaaagataatgggacatggacccagctgtggctggtatcagactaccatgagcatggc
tctttgtttgactacctgaaccgctacaccgtcaccgtggagggcatgatcaaactttcc
ctgtccactgccagcggcctggcccacctccacatggagatcgttggcacgcaagggaag
ccggccatcgcccacagggacctgaaatctaagaacatcctggtgaagaagagcgggacg
tgctgcatcgctgacctgggcctggctgtgcgccacgactccgccactgacaccatcgac
attgcccccaaccacagagtaggaaccaaaaggtatatggcaccagaggtgctagacgac
tcgataaacatgaagcattttgagtcatttaagagggcagatatctacgccatgggcttg
gttttctgggagatagccagtagatgctctctagcaggcatcgttgaagactaccagctg
ccataccatgacttggtgcagtcagacccttctgtagaggagatgaggagggtggtgtgt
gagcagaagctacggcccaacattccaaaccgttggcagagctgtgaggctctgcgggta
atggctaagatcatgagggaatgctggtatgccaacggagccgcccgcctcactgcgcta
cgcatcaagaagactctttcccagctcagccaatcagagggcatcaagatgtag

DBGET integrated database retrieval system