KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112227851
Entry
112227851         CDS       T05605                                 

Definition
(RefSeq) uncharacterized protein LOC112227851
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112227851
Transcription factors [BR:otw03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112227851
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 112227851
NCBI-ProteinID: XP_024248568
Position
29
AA seq 678 aa
MIPPGDCMYAGRKRRKPVQKQKPATVSEKSNPSKRHRDRLNAELDRLASMLPFSPDIISK
LDKLSVLRLSVSYLRVKSFFTVTHEKPSNRKHISPSTNPLPEPRKDSLPMAMGNSVTESG
LLLESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHVDDRQEFRRQLHW
AMSPSQHGSSQDHHSATETGEDFVVSSLFHSQEAGGVAPEFSSFLNRCFISRVRCLLDST
SGFLTMQFQGRLKFLQGQKKKSGSGALLPPQLALFCVAVPLLLPSITEMKMKGMMMRGKQ
KSGGGIIPALDHGEREEHFRRHSGSVAMVDGGDPLLLNCTSPGGSQQRLKYKSEGGYYGQ
DEPLNYCKTSMGGVPHHKGPGSDSPWPMRPASGTVRAGQSGGYIPSNRLGKAGHYGKPYR
MSPSMCHGGGRGGEVYVPKMYGSLQTPDGSDPYCLGEAVKSENGYGECYDGRLLPEMPIK
VEQDSDSENGCDAYGRPWTCREPVDRRYGNGYGDNNSLQMKSEADYYEQYSPCQRGKAGI
SPISPPYNNGHFQNYNNVGGGRPLKSVINKDLSQFSPQRLSHSDPLCSSQSINCMDVYAS
GPVEHNKGYMQQDYKQGYEFKGHGLLHAIKREPMDSPPWSDGSSNDMSHAMGHSQRNVMP
HCVMNAGQHKANPYVYMQ
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgataccaccgggagactgcatgtatgcgggcaggaaaagaaggaagcccgttcaaaaa
cagaaaccggccacggtgagtgagaagtccaacccgtcaaagaggcaccgggaccgcctg
aatgcggagctggaccggctggccagcatgctgcccttttccccagacatcatctccaag
ctggataaactgtctgtgctgcgtctcagtgtcagctacctccgggtcaagagcttcttc
acagtgactcatgagaagccgtccaacagaaaacatatcagtccatccaccaaccccctc
cccgagcccagaaaagacagcctgcctatggctatgggcaacagcgtaacagagagtggg
ctccttctggagtccctgactggctttgcgctggtggtgagcagcgatggaatggtcttc
tatgcctcctccaccatcgtcgactacttgggcttccatcagacggacgtgatgcaccag
aacgtctttgactatatccatgtagatgaccggcaggagttcagaagacaactccactgg
gccatgagccccagccagcacggctcatcccaggaccaccattcagccacagaaactgga
gaagactttgtggtgagcagcctgttccattctcaggaggcggggggagttgctcctgag
ttctcttccttcctcaaccgctgtttcatctcccgtgtacgctgcctgctggacagcacc
tctggctttttgaccatgcagttccaggggcggctgaagttcctccagggacagaagaag
aagtcgggttcgggggccctgctacccccgcagctggccctgttctgtgtggctgtgcct
cttctgctgccctccatcacagagatgaagatgaagggcatgatgatgaggggcaagcag
aagagcggagggggcattatccctgcactagatcatggtgagagagaggagcacttcagg
aggcactctggcagtgtggcgatggtggatggcggggacccgctgctcctcaactgcacc
agccccggggggtcccagcagcgcctcaagtacaagtcggaggggggctactacggccag
gacgagcccctcaactactgcaagacctctatgggcggcgtcccccaccacaaaggccca
ggctcggactccccgtggcccatgcggcctgcctcagggaccgtccgggctgggcagagt
ggcggctacatcccctcaaatcgacttgggaaggcgggccactacggtaagccctaccgc
atgtcccccagcatgtgtcatggaggagggcgaggtggtgaggtctacgtgcccaagatg
tacgggagcctccagacccccgacggctcggacccctactgcttgggagaggcggtgaag
agcgagaatggctacggcgaatgctacgatggccgcctgctgcctgagatgcccatcaag
gtggagcaggactctgactctgagaacggctgtgacgcctatggccgtccgtggacgtgc
cgggagcccgtggaccgtcgctacggcaacggctacggcgacaacaacagccttcaaatg
aagtcggaggcggactactacgagcagtactcgccgtgccagcggggcaaggcgggtatc
agtcccatcagcccaccctacaacaacggccacttccagaactataataatgtggggggc
ggcaggcccttgaagagtgtgattaacaaggacctgtcccagttcagtccccagaggctg
tcccactcagaccccctctgtagcagccagagcatcaactgcatggacgtatatgcaagc
ggccctgtggagcacaacaagggctacatgcagcaggactacaagcagggctacgagttc
aaaggtcatggactgctccatgccataaagcgggaacccatggactcacccccgtggtcg
gacggcagcagcaacgacatgagtcacgccatggggcactctcagaggaacgttatgcca
cactgtgtgatgaacgctgggcagcacaaagccaacccctatgtttatatgcaatag

DBGET integrated database retrieval system