KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228262
Entry
112228262         CDS       T05605                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00230  Purine metabolism
otw00240  Pyrimidine metabolism
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112228262
   00240 Pyrimidine metabolism
    112228262
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     112228262
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_17 AAA_28 Thymidylate_kin
Other DBs
NCBI-GeneID: 112228262
NCBI-ProteinID: XP_024249205
Position
30
AA seq 264 aa
MATPPKRICSSPSFDNSFEKRTKKISIEGNIAAGKSTLVHILEKSSEEWEVIPEPIGKWC
NVQNTDNEYEELSTSQKSGGNLLQMLYDKPSRWSYTFQSYACLSRVRAQLQPPSAKLQQA
EKPVQFFERSVYSDRYIFASNLFESGDMNETEWAIYQDWHGWLLSQFESQIELDAMIYLR
ADPQRCMQRLHRRGREEEQGIPIEYLEQLHYKHECWLYHRSTQLDFEYLKDIPILVLDVN
DDFKNDRIKQEAVLDKVREFLSML
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcaacacctcctaagagaatatgttcaagtccaagttttgacaacagttttgagaaa
agaactaagaagatatccattgaaggaaacattgctgcagggaagtctacacttgtgcac
attttagaaaagtcttcagaagaatgggaggtcataccggagcccattgggaagtggtgc
aacgttcaaaacactgacaatgagtatgaggagctcagcacatctcagaagagtggaggc
aacctgctgcagatgctgtatgacaaacctagccgctggtcctacacattccagagttac
gcctgtctgagtcgtgtgcgggctcagctgcagcccccttctgcaaagttgcaacaggca
gagaaacctgtccagttctttgagcgctctgtttacagtgaccggtatatatttgcctcc
aacctatttgagtctggggacatgaatgagactgaatgggccatttaccaagactggcac
ggttggctgctctctcagtttgagtctcaaatcgagctggatgccatgatctaccttcgg
gctgacccacagagatgtatgcagaggctgcaccgccgaggacgggaggaggaacaagga
attccaattgaatatctggagcagctgcactataagcacgagtgctggctgtaccaccgc
agtactcaacttgattttgagtacctgaaagatatccctatcctggtcctggatgttaat
gacgacttcaagaatgatcgaattaagcaggaagctgtgctggacaaggtcagagaattc
ctcagcatgctgtga

DBGET integrated database retrieval system