KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112228827
Entry
112228827         CDS       T05605                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00100  Steroid biosynthesis
otw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    112228827 (tm7sf2)
Enzymes [BR:otw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     112228827 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 PEMT DUF1295 ICMT
Other DBs
NCBI-GeneID: 112228827
NCBI-ProteinID: XP_024250268
Position
30
AA seq 420 aa
MKFNKQKSPQAEKEFGGTLGATCIPVFLPLTVLYLLCVCRSPVASVLQWPPVLPPTAQLW
DPLAPVLILGWMALQSFFYLLPMGKLSEGMVLKDGSRLKYPINGFYALCSTAVLLTLSLW
LGMPLGYLFELLLPLAVCAIGVSFLLSLYLYICSFWAPHHALAQGGNTGNPLYDFFMGRE
LNPRIGSFDLKYFCELRPGLIGWVVINFGMLMKEVELRDSASLAMILVNGFQLLYVADAL
WNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYSLQAAFLVVHPQSLSPLGATAIVTLNG
AGYYIFRKSNSQKNQFRRDPTHPSVANLETIATATGKRLLVSGWWGLVRHPNYLGDLLMA
LAWSLPCGFNHLLPYFYVVYFTVLLIHREARDERHCRAKYGLAWDSYCRRVPYRIFPYIY
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaagttcaacaaacaaaaatccccacaagcagaaaaggaatttggggggactttgggt
gccacctgtatacctgtcttcttgcccttgacggtactttacctgctctgtgtatgtcgc
tcccctgtggccagcgtgctccagtggccccctgtcctgccccccacagcccagctatgg
gaccccctggcccctgttctcatactgggctggatggccctccagagcttcttttacctg
ctgcctatggggaagctgtctgaggggatggtgctaaaagatggctcgagactcaagtac
cccataaacggtttttatgccctttgcagcacagctgtgctgttgacattgtcactatgg
ctggggatgcctctggggtatctctttgagctgttgttgcccctggcagtgtgtgctatt
ggggtgtcattcctcctctccctgtacctctacatatgctccttctgggcccctcaccat
gcccttgcccaggggggaaacacaggaaaccccctgtatgatttctttatgggacgagag
ctgaacccgcggattggaagctttgatctgaagtatttttgtgagctgagaccaggtctg
attggctgggtggtgattaactttgggatgctaatgaaagaggtggagctacgggactcc
gcctccctggccatgatactggtcaacggcttccagctgctctatgtggcggatgctctg
tggaatgaggaggctgtgctgaccaccatggacatagtgcatgatggctttgggtttatg
ttggtctttggggacctggcctgggttccctttacgtacagcctgcaagctgccttcctg
gtcgtgcacccacagtcccttagtcctctaggagcaacagctatagtcacattgaatggt
gctgggtattatatcttcagaaaatcaaactcccagaagaaccaattcagacgggaccct
acgcatcccagtgttgcaaacctggagactattgccacagcaactgggaagcgccttttg
gtgtctggctggtggggcctcgtacgccatcctaactacctaggagaccttctcatggcc
ctggcatggtccctgccatgtggattcaaccatcttctaccttacttttatgttgtgtac
ttcactgtcctgttaattcaccgagaggcccgtgacgagaggcactgcagggccaagtat
ggcctggcatgggacagctactgcaggcgcgtgccctacaggatcttcccctatatctac
tga

DBGET integrated database retrieval system