KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112230322Help
Entry
112230322         CDS       T05605                                 

Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00600  Sphingolipid metabolism
otw01100  Metabolic pathways
otw04020  Calcium signaling pathway
otw04370  VEGF signaling pathway
otw04371  Apelin signaling pathway
Module
otw_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    112230322
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    112230322
   04371 Apelin signaling pathway
    112230322
   04020 Calcium signaling pathway
    112230322
Enzymes [BR:otw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     112230322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 112230322
NCBI-ProteinID: XP_024252324
Position
32
AA seq 572 aa AA seqDB search
MEPRITESDPPSYRNGITKVLRYGEFTTTGNRKVRYAVSLTERDLTIQKVTSTPAGRSKV
VFNLRDCVGCRAFSADDNADAGAYFSVYFYPFKRRWMSSGVARQRVEQCFRVALFQDPRA
NLEEAEKWAGTIRENSVRQQHLRNRVLYSAVHRPCSVMLLVNPHSGKGQALSLFTGHVQR
MLNEAGVPHTLVITERQNHARELVREADLSQWGALVIMSGDGLLFEVSLWLLGDPCSLED
WEEAIQTPLGILPGGSGNALAASIHHYSGAQPVSSEELLISCGFLLCKGLVSRMDLASVH
LGSSRSNPTRLFSFLSLAWGFVADVDVESEKYRHVGAARFTMGTLVRLASLRVYKGRLAY
LPVDEEDGQSPVSLEMTSMSPQHQPPLSAFCSSTLLCQPLKDSPCQNTAHLAFHNSRNSN
NAFKAKKRESMSANATLTGPPDSLLVPLDQPVPSDWVVVPEEDFVLMLAMYQSHLAKDLY
AAPDSTLDDGLIHLIYVRAGISRTALLRLFLAMEKGTHLANNSPHLVYTRVRALRLEPYS
SKGVITVDGEVVEYGPVQAQVHGGIARLITRL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgaggataaccgaatcggacccgccatcatatcgcaacggaatcaccaaggtt
ctgcggtacggggaattcacgaccacgggcaaccgaaaggtgaggtacgcggtgagttta
accgagagggacctcaccattcagaaggtcacgtcaacacctgcgggacggagcaaggtg
gttttcaacttgagggactgtgtcggctgccgggctttcagcgcagatgacaacgcggac
gcgggagcgtacttctcggtctatttctacccttttaaaagacgatggatgagctctggg
gtggccaggcaacgggtcgagcagtgctttcgggtggccctgttccaggacccacgcgcc
aacctggaggaggcagagaaatgggctggcaccatccgggagaactctgttcgtcagcaa
catttgagaaatcgcgtgctttacagtgcggtgcaccgtccctgcagcgtcatgctactg
gtgaacccccacagtgggaagggccaggccctcagcctcttcaccggacacgtccaacgc
atgcttaacgaggccggggtcccacacacactggtcatcactgagcggcagaaccatgcc
agggagttggtgagagaggctgacctgtcacagtggggtgctctagtcatcatgtccggg
gacggactgctgtttgaggtgagtctctggctgttgggtgacccctgctctctngaggac
tgggaggaggccatccagaccccactgggcatcctaccagggggctccggtaatgccctg
gctgcctctatacaccactactctggggcccagccggtgtcaagcgaggagctgctgatc
agctgtggcttcctgctgtgtaagggcctggtgtctcgcatggacctggcctctgtccac
ctgggctccagccgctccaaccccacgcgtctcttctccttcctctcgctggcctggggc
ttcgtggctgacgtggacgttgagagtgagaagtatcgccacgtgggcgccgcccgcttc
accatgggcacattggtcaggttggcatcattgagggtgtataagggccgtctggcatac
ctgccggttgacgaggaggatgggcaatcgccagtctcgttggagatgacaagcatgtca
cctcaacaccaaccgccattgtctgcattctgctcctccaccctcctctgccaacctttg
aaggactcgccgtgccagaacacagcccacctcgccttccacaactcccgtaactcaaac
aacgccttcaaggcgaagaagagggaatccatgtccgcaaatgccaccctaacaggcccg
ccagactctctcctggtgcccctggaccagcccgtgcccagcgactgggtggtggtgccc
gaggaggactttgtcctcatgctggccatgtaccagtctcacctggcaaaggacctgtat
gccgcgcccgactctacacttgatgacggcctcatccacctgatatacgtccgagcaggc
atatcgcgcacggccctgctccgtctcttcctggccatggagaagggcacccacctggcc
aacaacagcccccatctggtgtacacccgggtgcgggcgctgcggctggagccctactcg
tcaaaaggggtgatcacggtggatggggaggtggtggagtatgggccggtccaggcccag
gtacacggtgggattgccaggctcatcactagattataa

DBGET integrated database retrieval system