KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112231710Help
Entry
112231710         CDS       T05605                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial isoform X1
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Pathway
otw00020  Citrate cycle (TCA cycle)
otw00640  Propanoate metabolism
otw01100  Metabolic pathways
otw01200  Carbon metabolism
Module
otw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
otw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:otw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112231710
   00640 Propanoate metabolism
    112231710
Enzymes [BR:otw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     112231710
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     112231710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 112231710
NCBI-ProteinID: XP_024254201
Position
34
AA seq 368 aa AA seqDB search
MSHSRLFARLLLQQNGVRSCYTASRKNLYIDKDTKVICQGFTGKQGTFHSQQAIDYGSRL
VGGVSPGKGGRTHLGVPVFNSVKEAREGTGAEATVIYVPPPFAGAAIIEAIDAGMPLVVC
ITEGIPQQDMVKVKHKLLRQSTTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRS
GTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLEVFLQDPKTDGIILIGEIGGNA
EENAADYLKQHNSVTNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQQAG
VVVSMSPAQLGSTMFKEFEKRKMLVNGERQHPRPPPPISLTKPSTLILRSHCPPASYNLQ
TRPLLQFS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatagtagattgtttgcccggctgctcttgcagcaaaatggagtaaggagctgt
tatactgcttcaagaaagaacctctacattgataaagacaccaaagtcatttgccaaggc
ttcacagggaagcaggggacgtttcacagccagcaggcaatcgactatggctcccggcta
gtcggtggcgtatcccccggcaagggggggaggacacacctcggcgtgcccgtcttcaac
tctgtcaaggaggcgagagagggcaccggggcagaggccacagtgatctacgtgccccct
ccgttcgcgggtgccgccatcattgaggccattgacgccggcatgcccctggtggtgtgc
atcacagagggcatcccccagcaggacatggttaaggtcaaacacaagctgctgcgccag
agcaccacccgcctgatcggccccaactgccccggagttattaatccgggagaatgcaaa
atcgggatcatgccgggccacattcacaagaaaggaaggattggcattgtctcaaggtcg
ggaactctcacatacgaagctgtgcaccagactacacaagttggcctgggacagtctctc
tgcatcggcatcggtggggaccccttcaatgggacaaatttcatcgactgcctggaggtg
ttcctgcaggaccccaagactgacggcatcatcctgatcggcgagatcggcggcaacgcc
gaggagaatgctgccgattacctcaaacagcacaactctgtaacgaatgccaagcctgtg
gtgtctttcatcgccgggctcactgccccgccgggccgtaggatgggtcacgccggtgcc
atcatcgcagggggcaagggcggagccaaagagaagattgccgccctacagcaggcgggc
gttgtggtcagcatgtcccctgcccagctgggcagcaccatgttcaaggagtttgagaag
aggaagatgttggtaaacggcgagaggcaacacccccgcccccccccccccatctcccta
acgaagccgagcaccctgattttgaggtcgcactgccctccagcgtcctacaacttgcag
acccgccctctcctgcagttcagttga

DBGET integrated database retrieval system