KEGG   Oncorhynchus tshawytscha (Chinook salmon): 112234276
Entry
112234276         CDS       T05605                                 

Definition
(RefSeq) uncharacterized protein LOC112234276
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
otw  Oncorhynchus tshawytscha (Chinook salmon)
Brite
KEGG Orthology (KO) [BR:otw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:otw03000]
    112234276
Transcription factors [BR:otw03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112234276
SSDB
Motif
Pfam: PAS HLH PAS_3
Other DBs
NCBI-GeneID: 112234276
NCBI-ProteinID: XP_024258100
Position
Unknown
AA seq 680 aa
MIPPGDCMYAGRKRRKPIQKQKPATVSEKSNPSKRHRDRLNAELDRLASMLPFSPDIISK
LDKLSVLRLSVSYLRVKSFFTVNHEKPSSRKHISPSTNSVPDPRKDSLPVGNSITESGLL
LESLTGFALVVSSDGMVFFSSSNIVDYLGFHQTDVMQQNVFDYVHVDDRQEFRRQLHWAM
NPSQHHLVSGTDEDLVVSSLFHSQETGGVAPEFSSFLNRCFMSRVRCLLDSTSGFLTMQI
QGRLKFLQGQKRKWGSGAPLPPQLALFCVAVPLLLPSITEMKMNNMMMRGKHKSGGCIIT
TLEYSEREEQLRRQAGSAGGVVDGGEALLLNCSKLGGPQHRRHAPWTPLSKDSLKYKTEC
GQDEPLNYCKTSMGGVPHHKGPGLDSLWPMRPASGPIRGGQSGGYTPSNRLGKGGHYGKP
YRMSPSMCHGGGRGGEIYVPRMYESLQSPGGLDLYCVGEEVKSECYGNLLLPEMPIKVEQ
DSDSENGCDTYGRPWPCREPLDHRYHDGNSYVDNNGLHMKSEADYYEQYSSCQRGKAGIS
PISPPYNNGHFQDYNNMVGSGSRPLKVNKDLSQFSPQRLSHPDPLCSSQSINCIDVYASG
PMEHSNKGYVQQQQQDKLSYEFKGHGPRQTIKQEPADSPQWSDGSGHDMNRAAGHSQRSV
MPHRVMNAGQHKANPCVYMQ
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgattccaccaggagactgcatgtacgcgggcaggaagagaagaaaacccattcaaaaa
cagaaaccagcgactgtgagtgagaagtccaacccatccaagaggcaccgggaccgcctg
aacgcagagctggaccggctggccagcatgctacctttttccccagacatcatctccaag
ctagataaactgtccgtgctgcgcctcagtgtcagctacctccgggttaagagtttcttc
acagttaatcacgagaagccgtccagcagaaagcacatcagtccatccaccaactctgtc
cctgatcccaggaaagacagcctgcctgtgggcaacagcatcacagagagcggactcctt
ctggagtcccttactggctttgcgttggtggtgagcagcgatggaatggttttcttttcc
tcctcaaacatcgttgactatttgggcttccatcagacggatgtgatgcagcaaaacgtc
tttgattatgtccatgtggacgaccgacaagagttcagaagacagctccactgggccatg
aaccccagccagcaccacttagtctcaggaactgatgaagacttggtggtgagcagcctg
tttcattctcaggagacggggggagtcgctcctgagttctcctcctttctcaaccgttgt
ttcatgtcccgcgtgcgctgcctgctggacagcacctctggcttcctgaccatgcagatc
cagggccgactcaagttcctccaaggacagaagaggaagtggggctcgggggccccgcta
cccccccagctggccctgttctgtgtggccgtgccccttctgctgccctccatcactgag
atgaagatgaacaacatgatgatgaggggcaagcacaagagtggagggtgcatcatcact
acactagaatatagtgagagagaggagcagttgaggaggcaggctggcagtgcggggggg
gtagtcgatggcggggaagcgctcctcctcaactgctccaaacttggtggtccccaacat
cgccgccacgccccctggacgcccctgtccaaagacagcctcaagtacaagacagagtgt
ggacaggacgagcccctcaactactgcaaaacctccatgggcggcgtcccccaccacaaa
ggcccaggcctggactccctgtggcccatgcggcctgcctcggggcccatccgggggggg
caaagtggcggctacaccccctctaatcgactcgggaagggtgggcactatggcaagccc
taccgcatgtcccccagcatgtgccacggaggagggcgaggtggtgaaatctacgtgccc
aggatgtacgagagcctccagagccctggcggcttggacctgtactgcgtgggagaggag
gtgaagagcgagtgctatggcaacctcctgctgcctgagatgcccatcaaggtggagcag
gactcggattcggagaacggctgcgacacgtatggccgtccgtggccctgccgggagccc
ttggaccatcgctaccacgacggcaacagctacgtcgacaacaacggcctccatatgaag
tcggaggcggactactacgaacagtactcgtcgtgccagaggggcaaggcgggcatcagc
cccatcagcccgccctacaacaacggccacttccaggactataataacatggtgggcagt
ggcagcaggcccttgaaggtcaataaggacctgtcccagttcagtccccagaggttgtcc
cacccagaccccctgtgtagcagccagagcatcaactgcattgacgtgtacgcaagcggc
cccatggagcacagcaacaagggctacgtgcagcagcagcagcaggacaagttgagctac
gagttcaaaggtcacggaccgcgccagaccatcaagcaggagcccgcggactcaccccag
tggtcggacggcagcggccacgacatgaaccgtgccgcgggacactctcagagaagcgtt
atgcctcaccgtgtgatgaatgctgggcagcacaaagccaacccttgtgtttatatgcaa
tag

DBGET integrated database retrieval system